CD179b Antibody - #DF8516
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# DF8516, RRID:AB_2841721.
折りたたみ／展開
14.1; AGM2; CD179 antigen-like family member B; CD179b; CD179b antigen; Ig lambda 5; Ig lambda-5; IGL1; IGL5; IGLJ14.1; IGLL; Igll1; IGLL1_HUMAN; IGO; IGVPB; Immunoglobulin lambda like polypeptide 1 precursor; Immunoglobulin lambda-like polypeptide 1; Immunoglobulin omega polypeptide; Immunoglobulin omega polypeptide chain; Immunoglobulin related protein 14.1; Immunoglobulin-related protein 14.1; Lambda5; Pre B lymphocyte specific protein 2; VPREB2; Ig lambda-1 chain C regions; IGLC; immunoglobulin lambda constant 1 (Mcg marker); Immunoglobulin lambda constant region 1; Immunoglobulin: lambda light chain;
免疫原
P15814(IGLL1_HUMAN) >>Visit HPA database.
P0CG04(IGLC1_HUMAN) >>Visit HPA database.
Expressed only in pre-B-cells and a special B-cell line (which is surface Ig negative).
- P15814 IGLL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS
- P0CG04 IGLC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- P0CF74 IGLC6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS
- A0M8Q6 IGLC7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFNPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15814/P0CG04/P0CF74/A0M8Q6 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S76 | Phosphorylation | Uniprot | |
| S188 | Phosphorylation | Uniprot | |
| S191 | Phosphorylation | Uniprot | |
| Y192 | Phosphorylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| C87 | S-Nitrosylation | Uniprot |
研究背景
Critical for B-cell development.
Secreted.
Expressed only in pre-B-cells and a special B-cell line (which is surface Ig negative).
Associates non-covalently with VPREB1.
Constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen.
Secreted. Cell membrane.
Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked.
Constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen.
Secreted. Cell membrane.
Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked.
Constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen.
Secreted. Cell membrane.
Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked.
研究領域
· Human Diseases > Immune diseases > Primary immunodeficiency.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.