Sumo2/3/4 Antibody - #DF8750
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# DF8750, RRID:AB_2841954.
折りたたみ/展開
HSMT3; MGC117191; OTTHUMP00000115275; OTTHUMP00000115276; OTTHUMP00000115277; Sentrin 2; Small ubiquitin like modifier 2; Small ubiquitin related modifier 2; small ubiquitin-like modifier 3; small ubiquitin-related modifier 3; SMT3 homolog 1; SMT3 homolog 2; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 3; SMT3A; SMT3B; SMT3H1; SMT3H2; Sumo2; Sumo3; Ubiquitin like protein SMT3A; Ubiquitin like protein SMT3B; Small ubiquitin like modifier 3; Small ubiquitin related modifier 3; Small ubiquitin-related modifier 3; SMT3 homolog 1; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 3; SMT3, yeast, homolog 1; SMT3A; Smt3B; SMT3H1; SUMO-2; SUMO-3; sumo3; SUMO3_HUMAN; Ubiquitin like protein SMT3A; Ubiquitin-like protein SMT3B; dJ281H8.4; IDDM5; Small ubiquitin like modifier 4 protein; Small ubiquitin-like protein 4; Small ubiquitin-related modifier 4; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3H4; SUMO 4; SUMO-4; SUMO4; SUMO4_HUMAN;
免疫原
A synthesized peptide derived from human Sumo2/3/4, corresponding to a region within the internal amino acids.
Broadly expressed.
P55854 SUMO3_HUMAN:Expressed predominantly in liver.
Q6EEV6 SUMO4_HUMAN:Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.
- P61956 SUMO2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
- P55854 SUMO3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
- Q6EEV6 SUMO4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
研究背景
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2, CBX4 or ZNF451. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX.
Polymeric chains can be formed through Lys-11 cross-linking. Polymeric SUMO2 chains undergo 'Lys-6'-, 'Lys-11'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination by RNF4.
Cleavage of precursor form by SENP1 or SENP2 is necessary for function.
Monoubiquitinated N-terminally by UBE2W, which primes it for RNF4-dependent polyubiquitination by the UBE2V1-UBE2N heterodimer.
Nucleus. Nucleus>PML body.
Broadly expressed.
Belongs to the ubiquitin family. SUMO subfamily.
Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX.
Polymeric chains can be formed through Lys-11 cross-linking.
Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function.
Cytoplasm. Nucleus. Nucleus>PML body.
Expressed predominantly in liver.
Belongs to the ubiquitin family. SUMO subfamily.
Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I.
In contrast to SUMO1, SUMO2 and SUMO3, seems to be insensitive to sentrin-specific proteases due to the presence of Pro-90. This may impair processing to mature form and conjugation to substrates.
Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.
Belongs to the ubiquitin family. SUMO subfamily.
研究領域
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.