Phospho-PKC alpha (Tyr195) Antibody - #AF7240
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# AF7240, RRID:AB_2843680.
折りたたみ/展開
AAG6; Aging associated gene 6; aPKC; KPCA_HUMAN; PKC alpha; PKC-A; PKC-alpha; PKCA; PRKACA; PRKCA; Protein Kinase C alpha; Protein kinase C alpha type;
免疫原
- P17252 KPCA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P17252 基板として
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S10 | Phosphorylation | Uniprot | |
T11 | Phosphorylation | Uniprot | |
S13 | Phosphorylation | Uniprot | |
K38 | Ubiquitination | Uniprot | |
T48 | Phosphorylation | Uniprot | |
S51 | Phosphorylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
K91 | Ubiquitination | Uniprot | |
K105 | Acetylation | Uniprot | |
K158 | Ubiquitination | Uniprot | |
K165 | Ubiquitination | Uniprot | |
K172 | Acetylation | Uniprot | |
K172 | Ubiquitination | Uniprot | |
T176 | Phosphorylation | Uniprot | |
Y195 | Phosphorylation | Uniprot | |
K197 | Acetylation | Uniprot | |
K197 | Ubiquitination | Uniprot | |
K199 | Ubiquitination | Uniprot | |
K205 | Ubiquitination | Uniprot | |
S208 | Phosphorylation | Uniprot | |
T214 | Phosphorylation | Uniprot | |
S226 | Phosphorylation | Q13188 (STK3) | Uniprot |
T228 | Phosphorylation | Q13188 (STK3) | Uniprot |
K230 | Ubiquitination | Uniprot | |
S234 | Phosphorylation | Uniprot | |
S241 | Phosphorylation | Uniprot | |
Y285 | Phosphorylation | Uniprot | |
Y286 | Phosphorylation | Uniprot | |
K309 | Ubiquitination | Uniprot | |
K316 | Ubiquitination | Uniprot | |
S319 | Phosphorylation | Uniprot | |
S321 | Phosphorylation | Uniprot | |
K325 | Ubiquitination | Uniprot | |
T337 | Phosphorylation | Uniprot | |
K347 | Ubiquitination | Uniprot | |
S349 | Phosphorylation | Uniprot | |
K352 | Ubiquitination | Uniprot | |
K359 | Ubiquitination | Uniprot | |
T361 | Phosphorylation | Uniprot | |
Y365 | Phosphorylation | Uniprot | |
K368 | Ubiquitination | Uniprot | |
K388 | Ubiquitination | Uniprot | |
K465 | Ubiquitination | Uniprot | |
S473 | Phosphorylation | Uniprot | |
K478 | Ubiquitination | Uniprot | |
K486 | Ubiquitination | Uniprot | |
T494 | Phosphorylation | Uniprot | |
T495 | Phosphorylation | Uniprot | |
T497 | Phosphorylation | Uniprot | |
T501 | Phosphorylation | Uniprot | |
Y504 | Phosphorylation | Uniprot | |
Y512 | Phosphorylation | Uniprot | |
K570 | Acetylation | Uniprot | |
K575 | Ubiquitination | Uniprot | |
K604 | Acetylation | Uniprot | |
K604 | Ubiquitination | Uniprot | |
K615 | Ubiquitination | Uniprot | |
K621 | Ubiquitination | Uniprot | |
K628 | Acetylation | Uniprot | |
K628 | Ubiquitination | Uniprot | |
T638 | Phosphorylation | P28482 (MAPK1) , P17252 (PRKCA) | Uniprot |
S651 | Phosphorylation | Uniprot | |
S657 | Phosphorylation | P17252 (PRKCA) , Q05513 (PRKCZ) | Uniprot |
Y658 | Phosphorylation | P43405 (SYK) | Uniprot |
S670 | Phosphorylation | Uniprot |
PTMs - P17252 酵素として
Substrate | Site | Source |
---|---|---|
A0A024R2E4 (ATP2B2) | T1094 | Uniprot |
O00161 (SNAP23) | S23 | Uniprot |
O00161-1 (SNAP23) | T24 | Uniprot |
O00161-2 (SNAP23) | S108 | Uniprot |
O00161 (SNAP23) | S161 | Uniprot |
O00168 (FXYD1) | S88 | Uniprot |
O14493 (CLDN4) | S194 | Uniprot |
O14745 (SLC9A3R1) | S77 | Uniprot |
O14745 (SLC9A3R1) | S162 | Uniprot |
O14745 (SLC9A3R1) | S339 | Uniprot |
O14745 (SLC9A3R1) | S340 | Uniprot |
O14920 (IKBKB) | S177 | Uniprot |
O14920 (IKBKB) | S181 | Uniprot |
O14939 (PLD2) | S243 | Uniprot |
O14939 (PLD2) | T252 | Uniprot |
O14950 (MYL12B) | T10 | Uniprot |
O14950 (MYL12B) | T19 | Uniprot |
O14950 (MYL12B) | S20 | Uniprot |
O14986 (PIP5K1B) | S413 | Uniprot |
O15217 (GSTA4) | T193 | Uniprot |
O15350 (TP73) | S388 | Uniprot |
O15519-2 (CFLAR) | S193 | Uniprot |
O43526-4 (KCNQ2) | S520 | Uniprot |
O43526-3 (KCNQ2) | S523 | Uniprot |
O43526-4 (KCNQ2) | S527 | Uniprot |
O43526-3 (KCNQ2) | S530 | Uniprot |
O43526-2 (KCNQ2) | S533 | Uniprot |
O43526-2 (KCNQ2) | S540 | Uniprot |
O43526-1 (KCNQ2) | S551 | Uniprot |
O43526-1 (KCNQ2) | S558 | Uniprot |
O60479 (DLX3) | T134 | Uniprot |
O60479 (DLX3) | S137 | Uniprot |
O60479 (DLX3) | S138 | Uniprot |
O60479 (DLX3) | S182 | Uniprot |
O60500 (NPHS1) | T1120 | Uniprot |
O60500 (NPHS1) | T1125 | Uniprot |
O60716 (CTNND1) | S879 | Uniprot |
O60825-1 (PFKFB2) | T475 | Uniprot |
O60869-2 (EDF1) | T91 | Uniprot |
O60928 (KCNJ13) | S201 | Uniprot |
O60941 (DTNB) | T69 | Uniprot |
O60941 (DTNB) | T179 | Uniprot |
O60941 (DTNB) | T212 | Uniprot |
O75376 (NCOR1) | S70 | Uniprot |
O75469 (NR1I2) | T408 | Uniprot |
O75689-1 (ADAP1) | S87 | Uniprot |
O75689 (ADAP1) | T276 | Uniprot |
O76090 (BEST1) | S358 | Uniprot |
O94759-3 (TRPM2) | S39 | Uniprot |
O94806 (PRKD3) | S731 | Uniprot |
O94992 (HEXIM1) | S158 | Uniprot |
O95243 (MBD4) | S165 | Uniprot |
O95243 (MBD4) | S262 | Uniprot |
O95471 (CLDN7) | S204 | Uniprot |
O95644-5 (NFATC1) | S232 | Uniprot |
O95644-2 (NFATC1) | S245 | Uniprot |
O95644-5 (NFATC1) | S256 | Uniprot |
O95644-4 (NFATC1) | S269 | Uniprot |
O95644-5 (NFATC1) | S281 | Uniprot |
O95644-4 (NFATC1) | S294 | Uniprot |
O95786 (DDX58) | S8 | Uniprot |
O95786 (DDX58) | T170 | Uniprot |
O96004 (HAND1) | S98 | Uniprot |
O96004 (HAND1) | T107 | Uniprot |
O96004 (HAND1) | S109 | Uniprot |
P00533 (EGFR) | T678 | Uniprot |
P00749 (PLAU) | S158 | Uniprot |
P00749 (PLAU) | S323 | Uniprot |
P01116-2 (KRAS) | S181 | Uniprot |
P01589 (IL2RA) | S268 | Uniprot |
P01589 (IL2RA) | T271 | Uniprot |
P01730 (CD4) | S433 | Uniprot |
P01730 (CD4) | S440 | Uniprot |
P02545-2 (LMNA) | T19 | Uniprot |
P02545-3 (LMNA) | S403 | Uniprot |
P02545-2 (LMNA) | S404 | Uniprot |
P02545-2 (LMNA) | S525 | Uniprot |
P02686-4 (MBP) | S8 | Uniprot |
P02686-6 (MBP) | S13 | Uniprot |
P02686-3 (MBP) | S57 | Uniprot |
P02686-5 (MBP) | S116 | Uniprot |
P02686-6 (MBP) | S122 | Uniprot |
P02686-5 (MBP) | S133 | Uniprot |
P02686-1 (MBP) | S141 | Uniprot |
P02686-3 (MBP) | S142 | Uniprot |
P02686-1 (MBP) | S146 | Uniprot |
P02686-4 (MBP) | S148 | Uniprot |
P02686-6 (MBP) | S151 | Uniprot |
P02686-5 (MBP) | S152 | Uniprot |
P02686-3 (MBP) | S159 | Uniprot |
P02686-5 (MBP) | S162 | Uniprot |
P02686-4 (MBP) | S167 | Uniprot |
P02686-4 (MBP) | S177 | Uniprot |
P02686-3 (MBP) | S178 | Uniprot |
P02686-3 (MBP) | S188 | Uniprot |
P02686-1 (MBP) | S190 | Uniprot |
P02686-1 (MBP) | S249 | Uniprot |
P02686-1 (MBP) | S266 | Uniprot |
P02686-1 (MBP) | S285 | Uniprot |
P02686-1 (MBP) | S295 | Uniprot |
P02786 (TFRC) | S24 | Uniprot |
P04004 (VTN) | S381 | Uniprot |
P04004 (VTN) | S386 | Uniprot |
P04004 (VTN) | S393 | Uniprot |
P04004 (VTN) | S397 | Uniprot |
P04049 (RAF1) | S43 | Uniprot |
P04049 (RAF1) | S233 | Uniprot |
P04049 (RAF1) | S497 | Uniprot |
P04049 (RAF1) | S499 | Uniprot |
P04049 (RAF1) | S619 | Uniprot |
P04083 (ANXA1) | S27 | Uniprot |
P04083 (ANXA1) | S28 | Uniprot |
P04439 (HLA-A) | S359 | Uniprot |
P04626 (ERBB2) | T686 | Uniprot |
P04637-1 (TP53) | S371 | Uniprot |
P04637 (TP53) | S376 | Uniprot |
P04637 (TP53) | T377 | Uniprot |
P04637-1 (TP53) | S378 | Uniprot |
P05107 (ITGB2) | S745 | Uniprot |
P05107 (ITGB2) | T758 | Uniprot |
P05107 (ITGB2) | T760 | Uniprot |
P05114 (HMGN1) | S7 | Uniprot |
P05114 (HMGN1) | S21 | Uniprot |
P05114 (HMGN1) | S25 | Uniprot |
P05204 (HMGN2) | S25 | Uniprot |
P05204 (HMGN2) | S29 | Uniprot |
P05556 (ITGB1) | S785 | Uniprot |
P05783 (KRT18) | S53 | Uniprot |
P06127 (CD5) | T434 | Uniprot |
P06127 (CD5) | T436 | Uniprot |
P06213 (INSR) | S1062 | Uniprot |
P06213 (INSR) | S1064 | Uniprot |
P06213-1 (INSR) | T1362 | Uniprot |
P06239 (LCK) | S42 | Uniprot |
P06730-1 (EIF4E) | S209 | Uniprot |
P07355 (ANXA2) | S12 | Uniprot |
P07355-1 (ANXA2) | S26 | Uniprot |
P07355-2 (ANXA2) | S44 | Uniprot |
P07949 (RET) | T675 | Uniprot |
P08034 (GJB1) | S229 | Uniprot |
P08034 (GJB1) | S233 | Uniprot |
P08100 (RHO) | S334 | Uniprot |
P08100 (RHO) | T336 | Uniprot |
P08183 (ABCB1) | S661 | Uniprot |
P08183 (ABCB1) | S667 | Uniprot |
P08183 (ABCB1) | S671 | Uniprot |
P08253 (MMP2) | S160 | Uniprot |
P08253 (MMP2) | T250 | Uniprot |
P08253 (MMP2) | S365 | Uniprot |
P08253 (MMP2) | T377 | Uniprot |
P08253 (MMP2) | T378 | Uniprot |
P08567 (PLEK) | S113 | Uniprot |
P08567 (PLEK) | S117 | Uniprot |
P08581 (MET) | S985 | Uniprot |
P08670 (VIM) | S5 | Uniprot |
P08670 (VIM) | S7 | Uniprot |
P08670 (VIM) | S8 | Uniprot |
P08670 (VIM) | S9 | Uniprot |
P08670 (VIM) | S10 | Uniprot |
P08670 (VIM) | S25 | Uniprot |
P08670 (VIM) | S26 | Uniprot |
P08670 (VIM) | S34 | Uniprot |
P08670 (VIM) | S39 | Uniprot |
P08670 (VIM) | S42 | Uniprot |
P08684 (CYP3A4) | T92 | Uniprot |
P08684 (CYP3A4) | S100 | Uniprot |
P08684 (CYP3A4) | T103 | Uniprot |
P08684 (CYP3A4) | S116 | Uniprot |
P08684 (CYP3A4) | S119 | Uniprot |
P08684 (CYP3A4) | S131 | Uniprot |
P08684 (CYP3A4) | S134 | Uniprot |
P08684 (CYP3A4) | T136 | Uniprot |
P08684 (CYP3A4) | S139 | Uniprot |
P08684 (CYP3A4) | S259 | Uniprot |
P08684 (CYP3A4) | T264 | Uniprot |
P08684 (CYP3A4) | T284 | Uniprot |
P08684 (CYP3A4) | S398 | Uniprot |
P08684 (CYP3A4) | S420 | Uniprot |
P08833 (IGFBP1) | S126 | Uniprot |
P08833 (IGFBP1) | S144 | Uniprot |
P08833 (IGFBP1) | S194 | Uniprot |
P09211 (GSTP1) | S185 | Uniprot |
P09651 (HNRNPA1) | S95 | Uniprot |
P09693 (CD3G) | S148 | Uniprot |
P09758 (TACSTD2) | S303 | Uniprot |
P10275 (AR) | S579 | Uniprot |
P10415-1 (BCL2) | S24 | Uniprot |
P10415 (BCL2) | S70 | Uniprot |
P10451-5 (SPP1) | S148 | Uniprot |
P10588 (NR2F6) | S83 | Uniprot |
P10599 (TXN) | T100 | Uniprot |
P10636-8 (MAPT) | S258 | Uniprot |
P10636-8 (MAPT) | S293 | Uniprot |
P10636-8 (MAPT) | S305 | Uniprot |
P10636-8 (MAPT) | S324 | Uniprot |
P10636-8 (MAPT) | S352 | Uniprot |
P10721-1 (KIT) | S741 | Uniprot |
P10721 (KIT) | S746 | Uniprot |
P10721-1 (KIT) | S821 | Uniprot |
P10721-1 (KIT) | S959 | Uniprot |
P11234 (RALB) | S198 | Uniprot |
P11387 (TOP1) | S21 | Uniprot |
P11388-1 (TOP2A) | S29 | Uniprot |
P11473 (VDR) | S51 | Uniprot |
P11831 (SRF) | T159 | Uniprot |
P11831 (SRF) | S162 | Uniprot |
P12931-1 (SRC) | S12 | Uniprot |
P13498 (CYBA) | T147 | Uniprot |
P13569 (CFTR) | S660 | Uniprot |
P13569-1 (CFTR) | S686 | Uniprot |
P13569 (CFTR) | S737 | Uniprot |
P13569-1 (CFTR) | S790 | Uniprot |
P13569 (CFTR) | S795 | Uniprot |
P13569 (CFTR) | S813 | Uniprot |
P13726 (F3) | S285 | Uniprot |
P13726 (F3) | S290 | Uniprot |
P14136-1 (GFAP) | S13 | Uniprot |
P14136-1 (GFAP) | S17 | Uniprot |
P14136-1 (GFAP) | S38 | Uniprot |
P14598 (NCF1) | S303 | Uniprot |
P14598 (NCF1) | S304 | Uniprot |
P14598 (NCF1) | S315 | Uniprot |
P14598 (NCF1) | S320 | Uniprot |
P14598 (NCF1) | S328 | Uniprot |
P14598 (NCF1) | S359 | Uniprot |
P14598 (NCF1) | S370 | Uniprot |
P14598 (NCF1) | S379 | Uniprot |
P15172 (MYOD1) | T115 | Uniprot |
P15311 (EZR) | T567 | Uniprot |
P15336 (ATF2) | S121 | Uniprot |
P15382 (KCNE1) | S102 | Uniprot |
P16070 (CD44) | S672 | Uniprot |
P16144 (ITGB4) | S1356 | Uniprot |
P16144 (ITGB4) | S1360 | Uniprot |
P16144 (ITGB4) | S1364 | Uniprot |
P16144 (ITGB4) | S1494 | Uniprot |
P16150 (SPN) | S351 | Uniprot |
P16671 (CD36) | T92 | Uniprot |
P17252 (PRKCA) | T638 | Uniprot |
P17252 (PRKCA) | S657 | Uniprot |
P17302 (GJA1) | S262 | Uniprot |
P17302 (GJA1) | S368 | Uniprot |
P17812 (CTPS1) | T455 | Uniprot |
P17812 (CTPS1) | S462 | Uniprot |
P17844-1 (DDX5) | S557 | Uniprot |
P18031 (PTPN1) | S378 | Uniprot |
P18206-2 (VCL) | S1033 | Uniprot |
P18206-2 (VCL) | S1045 | Uniprot |
P18206-1 (VCL) | S1101 | Uniprot |
P18206-1 (VCL) | S1113 | Uniprot |
P18507-2 (GABRG2) | S366 | Uniprot |
P18507-3 (GABRG2) | S406 | Uniprot |
P19021-2 (PAM) | S822 | Uniprot |
P19021-2 (PAM) | S827 | Uniprot |
P19021-4 (PAM) | S843 | Uniprot |
P19021-4 (PAM) | S848 | Uniprot |
P19021-3 (PAM) | S861 | Uniprot |
P19021-3 (PAM) | S866 | Uniprot |
P19021-5 (PAM) | S930 | Uniprot |
P19021-5 (PAM) | S935 | Uniprot |
P19086 (GNAZ) | S16 | Uniprot |
P19086 (GNAZ) | S27 | Uniprot |
P19174 (PLCG1) | S1248 | Uniprot |
P19429 (TNNI3) | S23 | Uniprot |
P19429 (TNNI3) | S24 | Uniprot |
P19429 (TNNI3) | S42 | Uniprot |
P19429 (TNNI3) | S44 | Uniprot |
P19429 (TNNI3) | S77 | Uniprot |
P19429 (TNNI3) | T143 | Uniprot |
P19429 (TNNI3) | S199 | Uniprot |
P20020-3 (ATP2B1) | T1116 | Uniprot |
P21359-2 (NF1) | S2808 | Uniprot |
P21399 (ACO1) | S138 | Uniprot |
P21399 (ACO1) | S711 | Uniprot |
P21730 (C5AR1) | S314 | Uniprot |
P21730 (C5AR1) | S317 | Uniprot |
P21730 (C5AR1) | S327 | Uniprot |
P21730 (C5AR1) | S332 | Uniprot |
P21730 (C5AR1) | S334 | Uniprot |
P21730 (C5AR1) | S338 | Uniprot |
P21731 (TBXA2R) | S324 | Uniprot |
P21731 (TBXA2R) | S329 | Uniprot |
P21731 (TBXA2R) | S331 | Uniprot |
P21731 (TBXA2R) | T337 | Uniprot |
P21731-2 (TBXA2R) | T399 | Uniprot |
P22460 (KCNA5) | T15 | Uniprot |
P22681 (CBL) | S619 | Uniprot |
P22681 (CBL) | S623 | Uniprot |
P22681 (CBL) | S639 | Uniprot |
P22681 (CBL) | S642 | Uniprot |
P23528 (CFL1) | S23 | Uniprot |
P23528 (CFL1) | S24 | Uniprot |
P23677 (ITPKA) | T311 | Uniprot |
P24046-1 (GABRR1) | S431 | Uniprot |
P24046-1 (GABRR1) | S440 | Uniprot |
P24046-1 (GABRR1) | S443 | Uniprot |
P24046-1 (GABRR1) | S444 | Uniprot |
P24046-1 (GABRR1) | S447 | Uniprot |
P24844 (MYL9) | S2 | Uniprot |
P24844 (MYL9) | S3 | Uniprot |
P24844 (MYL9) | T10 | Uniprot |
P25098 (GRK2) | S29 | Uniprot |
P28329-3 (CHAT) | T255 | Uniprot |
P28329-3 (CHAT) | S346 | Uniprot |
P28329-3 (CHAT) | S347 | Uniprot |
P28329 (CHAT) | T373 | Uniprot |
P28329-3 (CHAT) | S440 | Uniprot |
P28329 (CHAT) | S464 | Uniprot |
P28329 (CHAT) | S465 | Uniprot |
P28329-3 (CHAT) | S476 | Uniprot |
P28329 (CHAT) | S558 | Uniprot |
P28329 (CHAT) | S594 | Uniprot |
P29350-1 (PTPN6) | S591 | Uniprot |
P29353-7 (SHC1) | S29 | Uniprot |
P29353-1 (SHC1) | S139 | Uniprot |
P29474 (NOS3) | T495 | Uniprot |
P29475-1 (NOS1) | S852 | Uniprot |
P29966 (MARCKS) | S27 | Uniprot |
P29966 (MARCKS) | S46 | Uniprot |
P29966 (MARCKS) | S81 | Uniprot |
P29966 (MARCKS) | S101 | Uniprot |
P29966 (MARCKS) | S118 | Uniprot |
P29966 (MARCKS) | S159 | Uniprot |
P29966 (MARCKS) | S163 | Uniprot |
P29966 (MARCKS) | S167 | Uniprot |
P29966 (MARCKS) | S170 | Uniprot |
P29972 (AQP1) | T157 | Uniprot |
P29972 (AQP1) | T239 | Uniprot |
P30086 (PEBP1) | S153 | Uniprot |
P30411 (BDKRB2) | S373 | Uniprot |
P30622 (CLIP1) | S312 | Uniprot |
P31431-1 (SDC4) | S179 | Uniprot |
P31645 (SLC6A4) | S149 | Uniprot |
P31645 (SLC6A4) | S277 | Uniprot |
P31645 (SLC6A4) | T603 | Uniprot |
P31749 (AKT1) | T308 | Uniprot |
P31749 (AKT1) | S473 | Uniprot |
P32004 (L1CAM) | T1172 | Uniprot |
P34741 (SDC2) | S187 | Uniprot |
P34741 (SDC2) | S188 | Uniprot |
P35367 (HRH1) | S396 | Uniprot |
P35367 (HRH1) | S398 | Uniprot |
P35367 (HRH1) | T478 | Uniprot |
P35368 (ADRA1B) | S396 | Uniprot |
P35368 (ADRA1B) | S402 | Uniprot |
P35368 (ADRA1B) | S406 | Uniprot |
P35368 (ADRA1B) | S410 | Uniprot |
P35368 (ADRA1B) | S412 | Uniprot |
P35398 (RORA) | S35 | Uniprot |
P35568 (IRS1) | S24 | Uniprot |
P35579 (MYH9) | S1916 | Uniprot |
P35611 (ADD1) | S716 | Uniprot |
P35611 (ADD1) | S726 | Uniprot |
P35612 (ADD2) | S713 | Uniprot |
P35612 (ADD2) | S726 | Uniprot |
P35869 (AHR) | S12 | Uniprot |
P35869 (AHR) | S36 | Uniprot |
P35900 (KRT20) | S13 | Uniprot |
P36542 (ATP5F1C) | S146 | Uniprot |
P36897 (TGFBR1) | T200 | Uniprot |
P37802 (TAGLN2) | S11 | Uniprot |
P37802 (TAGLN2) | T180 | Uniprot |
P37802 (TAGLN2) | S185 | Uniprot |
P38936 (CDKN1A) | S146 | Uniprot |
P38936 (CDKN1A) | S153 | Uniprot |
P41091 (EIF2S3) | T66 | Uniprot |
P41143 (OPRD1) | S344 | Uniprot |
P41180 (CASR) | T888 | Uniprot |
P41594-2 (GRM5) | S840 | Uniprot |
P41594-2 (GRM5) | T841 | Uniprot |
P42261 (GRIA1) | S832 | Uniprot |
P42261 (GRIA1) | S834 | Uniprot |
P42261 (GRIA1) | S836 | Uniprot |
P42261-1 (GRIA1) | S849 | Uniprot |
P42262 (GRIA2) | S683 | Uniprot |
P42262 (GRIA2) | S717 | Uniprot |
P42262 (GRIA2) | S880 | Uniprot |
P43119 (PTGIR) | S328 | Uniprot |
P43629 (KIR3DL1) | S415 | Uniprot |
P45379 (TNNT2) | S189 | Uniprot |
P45379-11 (TNNT2) | T200 | Uniprot |
P45379-6 (TNNT2) | T203 | Uniprot |
P45379 (TNNT2) | T204 | Uniprot |
P45379-10 (TNNT2) | T210 | Uniprot |
P45379-11 (TNNT2) | T281 | Uniprot |
P45379-6 (TNNT2) | T284 | Uniprot |
P45379-10 (TNNT2) | T291 | Uniprot |
P46940 (IQGAP1) | S1443 | Uniprot |
P48048 (KCNJ1) | S4 | Uniprot |
P48048 (KCNJ1) | S201 | Uniprot |
P48050 (KCNJ4) | T53 | Uniprot |
P48058 (GRIA4) | T850 | Uniprot |
P48058 (GRIA4) | S862 | Uniprot |
P48067-2 (SLC6A9) | T19 | Uniprot |
P48067-2 (SLC6A9) | S239 | Uniprot |
P48067-2 (SLC6A9) | T276 | Uniprot |
P48067-2 (SLC6A9) | T590 | Uniprot |
P48067-2 (SLC6A9) | S625 | Uniprot |
P49768 (PSEN1) | S346 | Uniprot |
P49795 (RGS19) | S24 | Uniprot |
P49795 (RGS19) | T201 | Uniprot |
P49802-5 (RGS7) | S434 | Uniprot |
P49840 (GSK3A) | S21 | Uniprot |
P49841 (GSK3B) | S9 | Uniprot |
P50552 (VASP) | S157 | Uniprot |
P51674-1 (GPM6A) | T10 | Uniprot |
P52565 (ARHGDIA) | S34 | Uniprot |
P52565 (ARHGDIA) | S96 | Uniprot |
P52566 (ARHGDIB) | S31 | Uniprot |
P53004 (BLVRA) | S149 | Uniprot |
P53004 (BLVRA) | S230 | Uniprot |
P55042 (RRAD) | S214 | Uniprot |
P55042 (RRAD) | S257 | Uniprot |
P55042 (RRAD) | S273 | Uniprot |
P55042 (RRAD) | S290 | Uniprot |
P55042 (RRAD) | S299 | Uniprot |
P55087 (AQP4) | S180 | Uniprot |
P55273 (CDKN2D) | S76 | Uniprot |
P55273 (CDKN2D) | T141 | Uniprot |
P56537 (EIF6) | S235 | Uniprot |
P60880 (SNAP25) | T138 | Uniprot |
P60880 (SNAP25) | S187 | Uniprot |
P60983 (GMFB) | S72 | Uniprot |
P61764-1 (STXBP1) | S306 | Uniprot |
P61764-2 (STXBP1) | S313 | Uniprot |
P78536 (ADAM17) | T735 | Uniprot |
P81274 (GPSM2) | S408 | Uniprot |
Q01814-1 (ATP2B2) | T1139 | Uniprot |
Q01844 (EWSR1) | S266 | Uniprot |
Q01954 (BNC1) | S541 | Uniprot |
Q01970 (PLCB3) | S1105 | Uniprot |
Q01995 (TAGLN) | S181 | Uniprot |
Q02156 (PRKCE) | S234 | Uniprot |
Q02156 (PRKCE) | S316 | Uniprot |
Q02156 (PRKCE) | S368 | Uniprot |
Q03060-16 (CREM) | S87 | Uniprot |
Q03721 (KCNC4) | S15 | Uniprot |
Q03721 (KCNC4) | S21 | Uniprot |
Q04637 (EIF4G1) | S1185 | Uniprot |
Q05193 (DNM1) | S778 | Uniprot |
Q05193-1 (DNM1) | S795 | Uniprot |
Q05209 (PTPN12) | S39 | Uniprot |
Q05209 (PTPN12) | S435 | Uniprot |
Q05682 (CALD1) | S643 | Uniprot |
Q05682 (CALD1) | S656 | Uniprot |
Q05682 (CALD1) | S677 | Uniprot |
Q05940 (SLC18A2) | S15 | Uniprot |
Q05940 (SLC18A2) | S18 | Uniprot |
Q06124-2 (PTPN11) | S576 | Uniprot |
Q06124 (PTPN11) | S580 | Uniprot |
Q06124 (PTPN11) | S595 | Uniprot |
Q06210-2 (GFPT1) | S205 | Uniprot |
Q06210-2 (GFPT1) | S235 | Uniprot |
Q06481 (APLP2) | T723 | Uniprot |
Q07617-1 (SPAG1) | S317 | Uniprot |
Q07869 (PPARA) | S179 | Uniprot |
Q07869 (PPARA) | S230 | Uniprot |
Q07954 (LRP1) | T4460 | Uniprot |
Q07954 (LRP1) | S4517 | Uniprot |
Q07954 (LRP1) | S4520 | Uniprot |
Q07954 (LRP1) | S4523 | Uniprot |
Q09472 (EP300) | S89 | Uniprot |
Q12791 (KCNMA1) | S1200 | Uniprot |
Q12809 (KCNH2) | S890 | Uniprot |
Q12879-1 (GRIN2A) | S1416 | Uniprot |
Q12959 (DLG1) | T657 | Uniprot |
Q13002 (GRIK2) | S868 | Uniprot |
Q13224 (GRIN2B) | S1303 | Uniprot |
Q13224 (GRIN2B) | S1323 | Uniprot |
Q13255 (GRM1) | T695 | Uniprot |
Q13303 (KCNAB2) | S266 | Uniprot |
Q13393 (PLD1) | S2 | Uniprot |
Q13393 (PLD1) | T147 | Uniprot |
Q13393 (PLD1) | S561 | Uniprot |
Q13418 (ILK) | T173 | Uniprot |
Q13418 (ILK) | T181 | Uniprot |
Q13507 (TRPC3) | S700 | Uniprot |
Q13507 (TRPC3) | S703 | Uniprot |
Q13507-3 (TRPC3) | S712 | Uniprot |
Q13522 (PPP1R1A) | S67 | Uniprot |
Q13522 (PPP1R1A) | T75 | Uniprot |
Q13574-4 (DGKZ) | S266 | Uniprot |
Q13574-3 (DGKZ) | S282 | Uniprot |
Q13769 (THOC5) | S5 | Uniprot |
Q13769 (THOC5) | S6 | Uniprot |
Q13976-2 (PRKG1) | T57 | Uniprot |
Q13976 (PRKG1) | T59 | Uniprot |
Q14432 (PDE3A) | S292 | Uniprot |
Q14432 (PDE3A) | S293 | Uniprot |
Q14432 (PDE3A) | S312 | Uniprot |
Q14432 (PDE3A) | S428 | Uniprot |
Q14432 (PDE3A) | S438 | Uniprot |
Q14432 (PDE3A) | S465 | Uniprot |
Q14432 (PDE3A) | S492 | Uniprot |
Q14469 (HES1) | S37 | Uniprot |
Q14469 (HES1) | S38 | Uniprot |
Q14994 (NR1I3) | T38 | Uniprot |
Q15080 (NCF4) | T154 | Uniprot |
Q15080 (NCF4) | S315 | Uniprot |
Q15121 (PEA15) | S104 | Uniprot |
Q15139 (PRKD1) | S738 | Uniprot |
Q15139 (PRKD1) | S742 | Uniprot |
Q15172 (PPP2R5A) | S41 | Uniprot |
Q15311 (RALBP1) | S118 | Uniprot |
Q15311 (RALBP1) | T297 | Uniprot |
Q15311 (RALBP1) | S353 | Uniprot |
Q15311 (RALBP1) | S509 | Uniprot |
Q15717 (ELAVL1) | S158 | Uniprot |
Q15717 (ELAVL1) | S221 | Uniprot |
Q15717 (ELAVL1) | S318 | Uniprot |
Q15762 (CD226) | S329 | Uniprot |
Q16236 (NFE2L2) | S40 | Uniprot |
Q16625-1 (OCLN) | S340 | Uniprot |
Q16658 (FSCN1) | S39 | Uniprot |
Q16760-2 (DGKD) | S22 | Uniprot |
Q16760-2 (DGKD) | S26 | Uniprot |
Q16760-1 (DGKD) | S66 | Uniprot |
Q16760-1 (DGKD) | S70 | Uniprot |
Q16875 (PFKFB3) | S461 | Uniprot |
Q5JVS0 (HABP4) | T354 | Uniprot |
Q5JVS0-1 (HABP4) | T375 | Uniprot |
Q5NUL3-2 (FFAR4) | T347 | Uniprot |
Q5NUL3-2 (FFAR4) | S350 | Uniprot |
Q5NUL3-2 (FFAR4) | S357 | Uniprot |
Q6UVK1 (CSPG4) | T2252 | Uniprot |
Q86UR1 (NOXA1) | S172 | Uniprot |
Q86VB7 (CD163) | S1084 | Uniprot |
Q8N0W4 (NLGN4X) | T707 | Uniprot |
Q8N556 (AFAP1) | S277 | Uniprot |
Q8N726 (CDKN2A) | T8 | Uniprot |
Q8NER1 (TRPV1) | S502 | Uniprot |
Q8NER1 (TRPV1) | S801 | Uniprot |
Q8NFA2-3 (NOXO1) | S154 | Uniprot |
Q8NFA2-3 (NOXO1) | T341 | Uniprot |
Q8NFA2 (NOXO1) | T346 | Uniprot |
Q8TD43 (TRPM4) | S1145 | Uniprot |
Q8TD43 (TRPM4) | S1152 | Uniprot |
Q8WTQ7 (GRK7) | S36 | Uniprot |
Q8WZ42 (TTN) | S11878 | Uniprot |
Q8WZ42 (TTN) | S12022 | Uniprot |
Q92681 (RSC1A1) | S366 | Uniprot |
Q92686 (NRGN) | S36 | Uniprot |
Q92837 (FRAT1) | S188 | Uniprot |
Q969H0 (FBXW7) | S10 | Uniprot |
Q969H0 (FBXW7) | S18 | Uniprot |
Q96A00 (PPP1R14A) | T38 | Uniprot |
Q96C90 (PPP1R14B) | T57 | Uniprot |
Q96KS0 (EGLN2) | S132 | Uniprot |
Q96KS0 (EGLN2) | S226 | Uniprot |
Q96KS0 (EGLN2) | S234 | Uniprot |
Q96MS0 (ROBO3) | S1330 | Uniprot |
Q96PH1-4 (NOX5) | S490 | Uniprot |
Q96PH1-4 (NOX5) | T494 | Uniprot |
Q96PH1-4 (NOX5) | S498 | Uniprot |
Q96PH1 (NOX5) | S536 | Uniprot |
Q96PH1 (NOX5) | T540 | Uniprot |
Q96PH1 (NOX5) | S544 | Uniprot |
Q96PY5-3 (FMNL2) | S1072 | Uniprot |
Q96RI1-2 (NR1H4) | S135 | Uniprot |
Q96RI1 (NR1H4) | S145 | Uniprot |
Q96RI1-2 (NR1H4) | S154 | Uniprot |
Q96RI1 (NR1H4) | S164 | Uniprot |
Q99418-2 (CYTH2) | S391 | Uniprot |
Q99418-1 (CYTH2) | S392 | Uniprot |
Q99801 (NKX3-1) | S48 | Uniprot |
Q9BQE3 (TUBA1C) | S158 | Uniprot |
Q9BQE3 (TUBA1C) | S165 | Uniprot |
Q9BR39 (JPH2) | S165 | Uniprot |
Q9BR76 (CORO1B) | S2 | Uniprot |
Q9BZL6 (PRKD2) | S706 | Uniprot |
Q9BZL6 (PRKD2) | S710 | Uniprot |
Q9BZL6 (PRKD2) | S876 | Uniprot |
Q9H1D0 (TRPV6) | T742 | Uniprot |
Q9H3Q1 (CDC42EP4) | S18 | Uniprot |
Q9H3Q1 (CDC42EP4) | S80 | Uniprot |
Q9HAN9 (NMNAT1) | S136 | Uniprot |
Q9NQ66-2 (PLCB1) | S887 | Uniprot |
Q9NQA5 (TRPV5) | S299 | Uniprot |
Q9NQA5 (TRPV5) | S654 | Uniprot |
Q9NRD5 (PICK1) | S77 | Uniprot |
Q9NRF2 (SH2B1) | S161 | Uniprot |
Q9NRF2 (SH2B1) | S165 | Uniprot |
Q9NRY4 (ARHGAP35) | S1221 | Uniprot |
Q9NRY4 (ARHGAP35) | T1226 | Uniprot |
Q9NRY4 (ARHGAP35) | S1236 | Uniprot |
Q9NS23-2 (RASSF1) | S197 | Uniprot |
Q9NS23-2 (RASSF1) | S203 | Uniprot |
Q9UBS0 (RPS6KB2) | S473 | Uniprot |
Q9UEY8-2 (ADD3) | S661 | Uniprot |
Q9UEY8-1 (ADD3) | S693 | Uniprot |
Q9UJY1 (HSPB8) | S14 | Uniprot |
Q9UJY1 (HSPB8) | T63 | Uniprot |
Q9UKG1 (APPL1) | S430 | Uniprot |
Q9UQ80 (PA2G4) | S360 | Uniprot |
Q9UQ80-1 (PA2G4) | S363 | Uniprot |
Q9UQ80 (PA2G4) | T366 | Uniprot |
Q9Y624-1 (F11R) | T70 | Uniprot |
Q9Y624-1 (F11R) | T92 | Uniprot |
Q9Y624 (F11R) | S284 | Uniprot |
Q9Y6H6 (KCNE3) | S82 | Uniprot |
研究背景
Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that is involved in positive and negative regulation of cell proliferation, apoptosis, differentiation, migration and adhesion, tumorigenesis, cardiac hypertrophy, angiogenesis, platelet function and inflammation, by directly phosphorylating targets such as RAF1, BCL2, CSPG4, TNNT2/CTNT, or activating signaling cascade involving MAPK1/3 (ERK1/2) and RAP1GAP. Involved in cell proliferation and cell growth arrest by positive and negative regulation of the cell cycle. Can promote cell growth by phosphorylating and activating RAF1, which mediates the activation of the MAPK/ERK signaling cascade, and/or by up-regulating CDKN1A, which facilitates active cyclin-dependent kinase (CDK) complex formation in glioma cells. In intestinal cells stimulated by the phorbol ester PMA, can trigger a cell cycle arrest program which is associated with the accumulation of the hyper-phosphorylated growth-suppressive form of RB1 and induction of the CDK inhibitors CDKN1A and CDKN1B. Exhibits anti-apoptotic function in glioma cells and protects them from apoptosis by suppressing the p53/TP53-mediated activation of IGFBP3, and in leukemia cells mediates anti-apoptotic action by phosphorylating BCL2. During macrophage differentiation induced by macrophage colony-stimulating factor (CSF1), is translocated to the nucleus and is associated with macrophage development. After wounding, translocates from focal contacts to lamellipodia and participates in the modulation of desmosomal adhesion. Plays a role in cell motility by phosphorylating CSPG4, which induces association of CSPG4 with extensive lamellipodia at the cell periphery and polarization of the cell accompanied by increases in cell motility. During chemokine-induced CD4(+) T cell migration, phosphorylates CDC42-guanine exchange factor DOCK8 resulting in its dissociation from LRCH1 and the activation of GTPase CDC42. Is highly expressed in a number of cancer cells where it can act as a tumor promoter and is implicated in malignant phenotypes of several tumors such as gliomas and breast cancers. Negatively regulates myocardial contractility and positively regulates angiogenesis, platelet aggregation and thrombus formation in arteries. Mediates hypertrophic growth of neonatal cardiomyocytes, in part through a MAPK1/3 (ERK1/2)-dependent signaling pathway, and upon PMA treatment, is required to induce cardiomyocyte hypertrophy up to heart failure and death, by increasing protein synthesis, protein-DNA ratio and cell surface area. Regulates cardiomyocyte function by phosphorylating cardiac troponin T (TNNT2/CTNT), which induces significant reduction in actomyosin ATPase activity, myofilament calcium sensitivity and myocardial contractility. In angiogenesis, is required for full endothelial cell migration, adhesion to vitronectin (VTN), and vascular endothelial growth factor A (VEGFA)-dependent regulation of kinase activation and vascular tube formation. Involved in the stabilization of VEGFA mRNA at post-transcriptional level and mediates VEGFA-induced cell proliferation. In the regulation of calcium-induced platelet aggregation, mediates signals from the CD36/GP4 receptor for granule release, and activates the integrin heterodimer ITGA2B-ITGB3 through the RAP1GAP pathway for adhesion. During response to lipopolysaccharides (LPS), may regulate selective LPS-induced macrophage functions involved in host defense and inflammation. But in some inflammatory responses, may negatively regulate NF-kappa-B-induced genes, through IL1A-dependent induction of NF-kappa-B inhibitor alpha (NFKBIA/IKBA). Upon stimulation with 12-O-tetradecanoylphorbol-13-acetate (TPA), phosphorylates EIF4G1, which modulates EIF4G1 binding to MKNK1 and may be involved in the regulation of EIF4E phosphorylation. Phosphorylates KIT, leading to inhibition of KIT activity. Phosphorylates ATF2 which promotes cooperation between ATF2 and JUN, activating transcription.
Cytoplasm. Cell membrane>Peripheral membrane protein. Mitochondrion membrane>Peripheral membrane protein. Nucleus.
Recruited in a circadian manner into a nuclear complex which also includes BMAL1 and RACK1 (By similarity). Interacts with ADAP1/CENTA1. Interacts with CSPG4. Binds to CAVIN2 in the presence of phosphatidylserine (By similarity). Interacts with PRKCABP/PICK1 (via PDZ domain). Interacts with TRIM41. Interacts with PARD3.
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
研究領域
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Gap junction. (View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > ErbB signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Phosphatidylinositol signaling system.
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Substance dependence > Morphine addiction.
· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.
· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.
· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Human Diseases > Cancers: Specific types > Glioma. (View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
· Human Diseases > Cancers: Overview > Choline metabolism in cancer. (View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Development > Axon guidance. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway. (View pathway)
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis. (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
· Organismal Systems > Environmental adaptation > Circadian entrainment.
· Organismal Systems > Nervous system > Long-term potentiation.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Nervous system > GABAergic synapse.
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Nervous system > Long-term depression.
· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels. (View pathway)
· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)
· Organismal Systems > Endocrine system > Melanogenesis.
· Organismal Systems > Endocrine system > Thyroid hormone synthesis.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
· Organismal Systems > Digestive system > Salivary secretion.
· Organismal Systems > Digestive system > Gastric acid secretion.
· Organismal Systems > Digestive system > Pancreatic secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.