Phospho-GSK3 alpha (Ser21) Antibody - #AF3336
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# AF3336, RRID:AB_2834751.
折りたたみ/展開
DKFZp686D0638; Glycogen synthase kinase 3 alpha; Glycogen synthase kinase-3 alpha; GSK 3 alpha; GSK 3A; GSK-3 alpha; Gsk3a; GSK3A_HUMAN; GSK3alpha; Serine/threonine protein kinase GSK3A;
免疫原
- P49840 GSK3A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49840 基板として
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
S7 | Phosphorylation | Uniprot | |
S14 | Phosphorylation | Uniprot | |
R16 | Methylation | Uniprot | |
T19 | Phosphorylation | Uniprot | |
S20 | Phosphorylation | Uniprot | |
S21 | Phosphorylation | Q96BR1 (SGK3) , Q05655 (PRKCD) , Q13554 (CAMK2B) , Q14164 (IKBKE) , P05129 (PRKCG) , P05771 (PRKCB) , P17612 (PRKACA) , P51812 (RPS6KA3) , P24723 (PRKCH) , P31749 (AKT1) , O94806 (PRKD3) , O00141 (SGK1) , P17252 (PRKCA) | Uniprot |
S39 | Phosphorylation | Uniprot | |
S41 | Phosphorylation | Uniprot | |
T46 | Phosphorylation | Uniprot | |
S52 | Phosphorylation | Uniprot | |
S63 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
S72 | Phosphorylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
T84 | Phosphorylation | Uniprot | |
S97 | Phosphorylation | Uniprot | |
T101 | Phosphorylation | Uniprot | |
K123 | Acetylation | Uniprot | |
Y134 | Phosphorylation | Uniprot | |
T141 | Phosphorylation | Uniprot | |
K166 | Ubiquitination | Uniprot | |
Y177 | Phosphorylation | Uniprot | |
Y180 | Phosphorylation | Uniprot | |
Y197 | Phosphorylation | Uniprot | |
K246 | Ubiquitination | Uniprot | |
K260 | Ubiquitination | Uniprot | |
S266 | Phosphorylation | Uniprot | |
K268 | Ubiquitination | Uniprot | |
S278 | Phosphorylation | P49840 (GSK3A) | Uniprot |
Y279 | Phosphorylation | P49840 (GSK3A) | Uniprot |
S282 | Phosphorylation | Uniprot | |
Y284 | Phosphorylation | Uniprot | |
Y285 | Phosphorylation | Uniprot | |
T338 | Phosphorylation | Uniprot | |
T340 | Phosphorylation | Uniprot | |
Y351 | Phosphorylation | Uniprot | |
K355 | Ubiquitination | Uniprot | |
K360 | Ubiquitination | Uniprot | |
K366 | Ubiquitination | Uniprot | |
T478 | Phosphorylation | Uniprot | |
T480 | Phosphorylation | Uniprot | |
S482 | Phosphorylation | Uniprot |
PTMs - P49840 酵素として
Substrate | Site | Source |
---|---|---|
O15084 (ANKRD28) | S1007 | Uniprot |
O75030-9 (MITF) | S298 | Uniprot |
O75030 (MITF) | S405 | Uniprot |
O75581 (LRP6) | S1544 | Uniprot |
P01106 (MYC) | T58 | Uniprot |
P05412 (JUN) | T239 | Uniprot |
P05412 (JUN) | S243 | Uniprot |
P05412 (JUN) | S249 | Uniprot |
P10636-7 (MAPT) | T152 | Uniprot |
P10636-7 (MAPT) | S173 | Uniprot |
P10636-7 (MAPT) | T176 | Uniprot |
P10636-8 (MAPT) | T231 | Uniprot |
P10636-8 (MAPT) | S235 | Uniprot |
P10636-8 (MAPT) | S262 | Uniprot |
P10636-6 (MAPT) | S266 | Uniprot |
P10636-8 (MAPT) | S324 | Uniprot |
P10636-8 (MAPT) | S396 | Uniprot |
P10636-8 (MAPT) | S404 | Uniprot |
P10636 (MAPT) | S579 | Uniprot |
P10636 (MAPT) | S641 | Uniprot |
P10636 (MAPT) | S713 | Uniprot |
P10636 (MAPT) | S721 | Uniprot |
P13807 (GYS1) | S641 | Uniprot |
P17812 (CTPS1) | S571 | Uniprot |
P20749 (BCL3) | S402 | Uniprot |
P20749 (BCL3) | S406 | Uniprot |
P22415 (USF1) | T153 | Uniprot |
P22415 (USF1) | S186 | Uniprot |
P23246 (SFPQ) | T687 | Uniprot |
P24864 (CCNE1) | T395 | Uniprot |
P31749 (AKT1) | T312 | Uniprot |
P35222 (CTNNB1) | S33 | Uniprot |
P35222 (CTNNB1) | S37 | Uniprot |
P35222 (CTNNB1) | T41 | Uniprot |
P49840 (GSK3A) | S278 | Uniprot |
P49840 (GSK3A) | Y279 | Uniprot |
Q00613-1 (HSF1) | S303 | Uniprot |
Q03060-16 (CREM) | S83 | Uniprot |
Q05397 (PTK2) | S722 | Uniprot |
Q07817 (BCL2L1) | S62 | Uniprot |
Q07820-2 (MCL1) | S159 | Uniprot |
Q07820-2 (MCL1) | T163 | Uniprot |
Q13144 (EIF2B5) | S540 | Uniprot |
Q13144 (EIF2B5) | S544 | Uniprot |
Q13563 (PKD2) | S76 | Uniprot |
Q16555 (DPYSL2) | S518 | Uniprot |
Q16584 (MAP3K11) | S789 | Uniprot |
Q16584 (MAP3K11) | S793 | Uniprot |
Q2M1Z3 (ARHGAP31) | T789 | Uniprot |
Q6R327 (RICTOR) | T1695 | Uniprot |
Q8NHW3 (MAFA) | S49 | Uniprot |
Q8NHW3 (MAFA) | T53 | Uniprot |
Q8NHW3 (MAFA) | T57 | Uniprot |
Q8NHW3 (MAFA) | S61 | Uniprot |
Q92597 (NDRG1) | S342 | Uniprot |
Q92597 (NDRG1) | S352 | Uniprot |
Q92597 (NDRG1) | S362 | Uniprot |
Q92908 (GATA6) | S37 | Uniprot |
Q96RR4 (CAMKK2) | S129 | Uniprot |
Q96RR4 (CAMKK2) | S133 | Uniprot |
Q96RR4 (CAMKK2) | S137 | Uniprot |
Q9BYG3 (NIFK) | S230 | Uniprot |
Q9BYG3 (NIFK) | T234 | Uniprot |
Q9NZ72 (STMN3) | S60 | Uniprot |
研究背景
Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle (By similarity). May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease. May be involved in the regulation of replication in pancreatic beta-cells (By similarity). Is necessary for the establishment of neuronal polarity and axon outgrowth (By similarity). Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation (By similarity). Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, leading to activate KAT5/TIP60 acetyltransferase activity and promote acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer. Negatively regulates extrinsic apoptotic signaling pathway via death domain receptors. Promotes the formation of an anti-apoptotic complex, made of DDX3X, BRIC2 and GSK3B, at death receptors, including TNFRSF10B. The anti-apoptotic function is most effective with weak apoptotic signals and can be overcome by stronger stimulation (By similarity).
Phosphorylated by AKT1 at Ser-21: upon insulin-mediated signaling, the activated PKB/AKT1 protein kinase phosphorylates and desactivates GSK3A, resulting in the dephosphorylation and activation of GYS1. Activated by phosphorylation at Tyr-279.
Monomer. Interacts with ARRB2 (By similarity). Interacts with AXIN1 and CTNNB1/beta-catenin. Interacts with CTNND2. Interacts with LMBR1L. Interacts with DDX3X. Interacts with TNFRSF10B.
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. GSK-3 subfamily.
研究領域
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Nervous system > Dopaminergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.