HLA-F Antibody - #DF12204
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# DF12204, RRID:AB_2845009.
折りたたみ/展開
CDA12; HLA 5.4; HLA class I histocompatibility antigen, alpha chain F; HLA class I molecule; HLA F antigen; HLA-CDA12; HLA-F; HLAF; HLAF_HUMAN; Leukocyte antigen F; MHC class I antigen F;
免疫原
A synthesized peptide derived from human HLA-F, corresponding to a region within the internal amino acids.
Expressed in resting B cells (at protein level). Expressed in secondary lymphoid organs rich in B and T cells such as the tonsils, spleen, and thymus (at protein level) (PubMed:10605026, PubMed:11169396). Expressed in the endothelial cells of the tonsils (PubMed:11169396). Expressed on activated lymphoid cells including B cells, NK cells, CD4+ T cells and memory T cells (at protein level) (PubMed:27455421, PubMed:20865824). Expressed in motor neurons of spinal cord (PubMed:26928464).
- P30511 HLAF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV
研究背景
Non-classical major histocompatibility class Ib molecule postulated to play a role in immune surveillance, immune tolerance and inflammation. Functions in two forms, as a heterotrimeric complex with B2M/beta-2 microglobulin and a peptide (peptide-bound HLA-F-B2M) and as an open conformer (OC) devoid of peptide and B2M (peptide-free OC). In complex with B2M, presents non-canonical self-peptides carrying post-translational modifications, particularly phosphorylated self-peptides. Peptide-bound HLA-F-B2M acts as a ligand for LILRB1 inhibitory receptor, a major player in maternal-fetal tolerance. Peptide-free OC acts as a ligand for KIR3DS1 and KIR3DL2 receptors. Upon interaction with activating KIR3DS1 receptor on NK cells, triggers NK cell degranulation and anti-viral cytokine production. Through interaction with KIR3DL2 receptor, inhibits NK and T cell effector functions. May interact with other MHC class I OCs to cross-present exogenous viral, tumor or minor histompatibility antigens to cytotoxic CD8+ T cells, triggering effector and memory responses. May play a role in inflammatory responses in the peripheral nervous system. Through interaction with KIR3DL2, may protect motor neurons from astrocyte-induced toxicity.
N-glycosylated.
Cell membrane>Single-pass type I membrane protein. Early endosome membrane. Lysosome membrane.
Note: For cross-presentation transits from the cell surface through endosomal pathway to lysosomes, where the peptide is generated from internalized exogenous antigen.
Expressed in resting B cells (at protein level). Expressed in secondary lymphoid organs rich in B and T cells such as the tonsils, spleen, and thymus (at protein level). Expressed in the endothelial cells of the tonsils. Expressed on activated lymphoid cells including B cells, NK cells, CD4+ T cells and memory T cells (at protein level). Expressed in motor neurons of spinal cord.
Belongs to the MHC class I family.
研究領域
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Immune diseases > Autoimmune thyroid disease.
· Human Diseases > Immune diseases > Allograft rejection.
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Human Diseases > Cardiovascular diseases > Viral myocarditis.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.