製品: ERK1/2 Antibody
カタログ: AF6975
タンパク質の説明: Rabbit polyclonal antibody to ERK1/2
アプリケーション: ELISA(peptide)
反応性: Human, Mouse, Rat
分子量: 41kD,43kD(Calculated).
ユニプロット: P28482 | P27361
RRID: AB_2847765

類似製品を見る>>

   サイズ 価格 在庫状況
 100ul $280 在庫あり
 200ul $350 在庫あり

リードタイム: 当日配達

For pricing and ordering contact:
お問い合わせ先

製品説明

ソース:
Rabbit
アプリケーション:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

反応性:
Human,Mouse,Rat
クローナリティ:
Polyclonal
特異性:
ERK1/2 Antibody detects endogenous levels of total ERK1/2.
RRID:
AB_2847765
引用形式: Affinity Biosciences Cat# AF6975, RRID:AB_2847765.
コンジュゲート:
Unconjugated.
精製:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
保存:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
別名:

折りたたみ/展開

ERK 1; ERK; ERK-1; ERK1; ERT 2; ERT2; Extracellular Signal Regulated Kinase 1; Extracellular signal related kinase 1; Extracellular signal-regulated kinase 1; HGNC6877; HS44KDAP; HUMKER1A; Insulin Stimulated MAP2 Kinase; Insulin-stimulated MAP2 kinase; MAP kinase 1; MAP kinase 3; MAP Kinase; MAP kinase isoform p44; MAPK 1; MAPK 3; MAPK; MAPK1; Mapk3; MGC20180; Microtubule Associated Protein 2 Kinase; Microtubule-associated protein 2 kinase; Mitogen Activated Protein Kinase 3; Mitogen-activated protein kinase 1; Mitogen-activated protein kinase 3; MK03_HUMAN; OTTHUMP00000174538; OTTHUMP00000174541; p44 ERK1; p44 MAPK; p44-ERK1; p44-MAPK; P44ERK1; P44MAPK; PRKM 3; PRKM3; Protein Kinase Mitogen Activated 3; ERK 2; ERK; ERK-2; ERT1; Extracellular Signal Regulated Kinase 2; Extracellular signal-regulated kinase 2; MAP kinase 1; MAP kinase 2; MAP kinase isoform p42; MAPK 1; MAPK 2; Mapk1; MAPK2; Mitogen-activated protein kinase 1; Mitogen-activated protein kinase 2; MK01_HUMAN; P38; P40; P41; p42-MAPK; P42MAPK; PRK

免疫原

免疫原:

A synthesized peptide derived from human ERK1/2.

Uniprot:
遺伝子(ID):
タンパク質配列:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP

PTMs - P28482/P27361 基板として

Site PTM Type Enzyme
A2 Acetylation
K32 Ubiquitination
S58 Phosphorylation
K72 Ubiquitination
T80 Phosphorylation
Y130 Phosphorylation
K155 Ubiquitination
S159 Phosphorylation
S170 Phosphorylation
K181 Acetylation
K181 Ubiquitination
T198 Phosphorylation
T202 Phosphorylation Q02750 (MAP2K1) , P36507 (MAP2K2)
Y204 Phosphorylation P27361 (MAPK3) , O60674 (JAK2) , Q02750 (MAP2K1) , P07949 (RET) , P06239 (LCK) , P36507 (MAP2K2)
T207 Phosphorylation Q02750 (MAP2K1) , P27361 (MAPK3)
Y210 Phosphorylation Q02750 (MAP2K1)
R211 Methylation
S219 Phosphorylation
K220 Ubiquitination
Y222 Phosphorylation
T223 Phosphorylation
S265 Phosphorylation
K287 Ubiquitination
K289 Ubiquitination
K294 Ubiquitination
K298 Ubiquitination
K302 Methylation
K302 Ubiquitination
R309 Methylation
K317 Ubiquitination
K357 Ubiquitination
K361 Methylation
K361 Ubiquitination
Site PTM Type Enzyme
A2 Acetylation
Y25 Phosphorylation
S29 Phosphorylation O00141 (SGK1)
Y36 Phosphorylation
Y43 Phosphorylation
K55 Ubiquitination
T63 Phosphorylation
C65 S-Nitrosylation
K99 Ubiquitination
Y113 Phosphorylation
K138 Ubiquitination
S142 Phosphorylation
K151 Ubiquitination
K164 Ubiquitination
C166 S-Nitrosylation
T181 Phosphorylation
T185 Phosphorylation Q02750 (MAP2K1) , P36507 (MAP2K2)
Y187 Phosphorylation P28482 (MAPK1) , P07949 (RET) , O60674 (JAK2) , Q02750 (MAP2K1) , P36507 (MAP2K2)
T190 Phosphorylation P28482 (MAPK1)
Y193 Phosphorylation
R194 Methylation
S202 Phosphorylation
K203 Ubiquitination
Y205 Phosphorylation
T206 Phosphorylation
S246 Phosphorylation P68400 (CSNK2A1) , P28482 (MAPK1)
S248 Phosphorylation P68400 (CSNK2A1)
K259 Ubiquitination
Y263 Phosphorylation
K270 Ubiquitination
K272 Ubiquitination
S284 Phosphorylation
K285 Ubiquitination
K292 Ubiquitination
T295 Phosphorylation
K300 Ubiquitination
K330 Ubiquitination
K340 Ubiquitination
K344 Ubiquitination
S360 Phosphorylation

PTMs - P28482/P27361 酵素として

Substrate Site Source
C9JLW8 (MCRIP1) S21 Uniprot
C9JLW8 (MCRIP1) T30 Uniprot
O00213 (APBB1) S175 Uniprot
O00213 (APBB1) S287 Uniprot
O00213 (APBB1) S347 Uniprot
O00213 (APBB1) T709 Uniprot
O00429 (DNM1L) S616 Uniprot
O14994 (SYN3) S470 Uniprot
O43521 (BCL2L11) S69 Uniprot
O43524 (FOXO3) S294 Uniprot
O43524 (FOXO3) S344 Uniprot
O43524 (FOXO3) S425 Uniprot
O43561-2 (LAT) T155 Uniprot
O43561 (LAT) T184 Uniprot
O60244 (MED14) S986 Uniprot
O60331 (PIP5K1C) S650 Uniprot
O60674 (JAK2) S523 Uniprot
O75030-9 (MITF) S73 Uniprot
O75581 (LRP6) S1490 Uniprot
O75581 (LRP6) T1572 Uniprot
O75582 (RPS6KA5) S360 Uniprot
O75582-2 (RPS6KA5) S376 Uniprot
O75582-1 (RPS6KA5) T581 Uniprot
O75582 (RPS6KA5) T700 Uniprot
O95644 (NFATC1) S172 Uniprot
O95997 (PTTG1) S165 Uniprot
P00533 (EGFR) T693 Uniprot
P01100 (FOS) T232 Uniprot
P01100 (FOS) T325 Uniprot
P01100 (FOS) T331 Uniprot
P01100 (FOS) S374 Uniprot
P02686 (MBP) S96 Uniprot
P02686 (MBP) T232 Uniprot
P03372 (ESR1) S104 Uniprot
P03372 (ESR1) S106 Uniprot
P03372 (ESR1) S118 Uniprot
P04049 (RAF1) S289 Uniprot
P04049 (RAF1) S296 Uniprot
P04049 (RAF1) S301 Uniprot
P04150 (NR3C1) S226 Uniprot
P04637 (TP53) S15 Uniprot
P04637 (TP53) S392 Uniprot
P05412 (JUN) S63 Uniprot
P05412 (JUN) S73 Uniprot
P05787-1 (KRT8) S74 Uniprot
P05787 (KRT8) S432 Uniprot
P06239 (LCK) S42 Uniprot
P06239 (LCK) S59 Uniprot
P06401 (PGR) S294 Uniprot
P07101-3 (TH) S31 Uniprot
P07101-4 (TH) S35 Uniprot
P07101-2 (TH) S58 Uniprot
P07101 (TH) S62 Uniprot
P08047 (SP1) S59 Uniprot
P08047 (SP1) T453 Uniprot
P08047 (SP1) T739 Uniprot
P09917 (ALOX5) S664 Uniprot
P10242 (MYB) S532 Uniprot
P10275 (AR) S516 Uniprot
P10275 (AR) S651 Uniprot
P10415 (BCL2) T56 Uniprot
P10415 (BCL2) S70 Uniprot
P10415 (BCL2) T74 Uniprot
P10415 (BCL2) S87 Uniprot
P10636-8 (MAPT) S46 Uniprot
P10636-8 (MAPT) T50 Uniprot
P10636-8 (MAPT) T153 Uniprot
P10636-8 (MAPT) T175 Uniprot
P10636-8 (MAPT) T181 Uniprot
P10636-8 (MAPT) S199 Uniprot
P10636-8 (MAPT) S202 Uniprot
P10636-8 (MAPT) T205 Uniprot
P10636-8 (MAPT) T212 Uniprot
P10636-8 (MAPT) T217 Uniprot
P10636-8 (MAPT) T231 Uniprot
P10636-8 (MAPT) S235 Uniprot
P10636-8 (MAPT) S396 Uniprot
P10636-8 (MAPT) S404 Uniprot
P10636-8 (MAPT) S422 Uniprot
P10828 (THRB) S142 Uniprot
P11362 (FGFR1) S777 Uniprot
P11388 (TOP2A) S1213 Uniprot
P11388 (TOP2A) S1247 Uniprot
P11388 (TOP2A) S1354 Uniprot
P11388 (TOP2A) S1361 Uniprot
P11388 (TOP2A) S1393 Uniprot
P12980 (LYL1) S36 Uniprot
P13631 (RARG) S77 Uniprot
P13631 (RARG) S79 Uniprot
P14598 (NCF1) S345 Uniprot
P14598 (NCF1) S348 Uniprot
P14784 (IL2RB) T476 Uniprot
P14921 (ETS1) T38 Uniprot
P15036 (ETS2) T72 Uniprot
P15056 (BRAF) S151 Uniprot
P15056 (BRAF) T401 Uniprot
P15056 (BRAF) T753 Uniprot
P15336 (ATF2) T69 Uniprot
P15336 (ATF2) T71 Uniprot
P15923-1 (TCF3) T355 Uniprot
P15976 (GATA1) S26 Uniprot
P16144 (ITGB4) S1356 Uniprot
P16220 (CREB1) S133 Uniprot
P16949 (STMN1) S25 Uniprot
P16949 (STMN1) S38 Uniprot
P17302 (GJA1) S255 Uniprot
P17302 (GJA1) S279 Uniprot
P17302 (GJA1) S282 Uniprot
P17480 (UBTF) T117 Uniprot
P17480 (UBTF) T201 Uniprot
P17535 (JUND) S100 Uniprot
P17542-1 (TAL1) S122 Uniprot
P17600 (SYN1) S62 Uniprot
P17600 (SYN1) S67 Uniprot
P17600 (SYN1) S551 Uniprot
P17655 (CAPN2) S50 Uniprot
P17676 (CEBPB) T235 Uniprot
P17861 (XBP1) S68 Uniprot
P17861 (XBP1) S181 Uniprot
P18545 (PDE6G) T22 Uniprot
P19419 (ELK1) S324 Uniprot
P19419 (ELK1) T336 Uniprot
P19419 (ELK1) S383 Uniprot
P19419 (ELK1) S389 Uniprot
P19419 (ELK1) S422 Uniprot
P19793 (RXRA) S260 Uniprot
P20339 (RAB5A) S123 Uniprot
P23396 (RPS3) T42 Uniprot
P23443 (RPS6KB1) S434 Uniprot
P24928 (POLR2A) S1619 Uniprot
P24928 (POLR2A) S1626 Uniprot
P24928 (POLR2A) S1647 Uniprot
P24928 (POLR2A) S1654 Uniprot
P24928 (POLR2A) S1668 Uniprot
P24928 (POLR2A) S1675 Uniprot
P24928 (POLR2A) S1696 Uniprot
P24928 (POLR2A) S1717 Uniprot
P24928 (POLR2A) S1724 Uniprot
P24928 (POLR2A) S1738 Uniprot
P24928 (POLR2A) S1766 Uniprot
P24928 (POLR2A) S1787 Uniprot
P24928 (POLR2A) S1864 Uniprot
P24928 (POLR2A) S1871 Uniprot
P24928 (POLR2A) S1878 Uniprot
P24928 (POLR2A) S1892 Uniprot
P24928 (POLR2A) S1899 Uniprot
P24928 (POLR2A) S1913 Uniprot
P24928 (POLR2A) S1920 Uniprot
P24928 (POLR2A) S1927 Uniprot
P24928 (POLR2A) S1934 Uniprot
P24928 (POLR2A) S1944 Uniprot
P24928 (POLR2A) S1951 Uniprot
P24941 (CDK2) T160 Uniprot
P25098 (GRK2) S670 Uniprot
P27361-3 (MAPK3) T202 Uniprot
P27361 (MAPK3) Y204 Uniprot
P27361 (MAPK3) T207 Uniprot
P27708 (CAD) T456 Uniprot
P27824 (CANX) S583 Uniprot
P28324 (ELK4) T361 Uniprot
P28324 (ELK4) T366 Uniprot
P28324 (ELK4) S381 Uniprot
P28324 (ELK4) S387 Uniprot
P28324 (ELK4) T420 Uniprot
P28324 (ELK4) S425 Uniprot
P28562 (DUSP1) S296 Uniprot
P28562 (DUSP1) S323 Uniprot
P28562 (DUSP1) S359 Uniprot
P28562 (DUSP1) S364 Uniprot
P28698 (MZF1) S256 Uniprot
P28698 (MZF1) S274 Uniprot
P28698 (MZF1) S294 Uniprot
P29353 (SHC1) S36 Uniprot
P29590-4 (PML) T28 Uniprot
P29590-4 (PML) S36 Uniprot
P29590-4 (PML) S38 Uniprot
P29590-4 (PML) S40 Uniprot
P29590-4 (PML) S527 Uniprot
P29590-4 (PML) S530 Uniprot
P30307 (CDC25C) S216 Uniprot
P31645 (SLC6A4) T616 Uniprot
P32121 (ARRB2) S14 Uniprot
P32121 (ARRB2) T276 Uniprot
P33076 (CIITA) S280 Uniprot
P33076 (CIITA) S288 Uniprot
P33981 (TTK) S821 Uniprot
P35228 (NOS2) S745 Uniprot
P35236-2 (PTPN7) T105 Uniprot
P35236-2 (PTPN7) S132 Uniprot
P35568 (IRS1) S616 Uniprot
P35658 (NUP214) S1710 Uniprot
P35658 (NUP214) S1809 Uniprot
P36956 (SREBF1) S117 Uniprot
P36956-4 (SREBF1) S147 Uniprot
P37231 (PPARG) S112 Uniprot
P40763 (STAT3) Y705 Uniprot
P40763-2 (STAT3) S726 Uniprot
P40763 (STAT3) S727 Uniprot
P41182 (BCL6) S333 Uniprot
P41182 (BCL6) S343 Uniprot
P41212 (ETV6) S213 Uniprot
P41212 (ETV6) S257 Uniprot
P42224 (STAT1) S727 Uniprot
P42229 (STAT5A) S780 Uniprot
P42702 (LIFR) S1044 Uniprot
P43364 (MAGEA11) S174 Uniprot
P43694 (GATA4) S105 Uniprot
P46527 (CDKN1B) T187 Uniprot
P47712 (PLA2G4A) S505 Uniprot
P49023-2 (PXN) S83 Uniprot
P49023-2 (PXN) S126 Uniprot
P49023 (PXN) S130 Uniprot
P49137 (MAPKAPK2) T222 Uniprot
P49137 (MAPKAPK2) T334 Uniprot
P49407-2 (ARRB1) S404 Uniprot
P49407-1 (ARRB1) S412 Uniprot
P49418 (AMPH) S293 Uniprot
P49418 (AMPH) S295 Uniprot
P49585 (PCYT1A) S315 Uniprot
P49675 (STAR) S233 Uniprot
P49715 (CEBPA) S21 Uniprot
P49790 (NUP153) S257 Uniprot
P49790 (NUP153) S320 Uniprot
P49790 (NUP153) S334 Uniprot
P49790 (NUP153) S338 Uniprot
P49790 (NUP153) T369 Uniprot
P49790 (NUP153) T388 Uniprot
P49790 (NUP153) T413 Uniprot
P49790 (NUP153) S516 Uniprot
P49790 (NUP153) S522 Uniprot
P49790 (NUP153) S529 Uniprot
P49815 (TSC2) S664 Uniprot
P49841 (GSK3B) T43 Uniprot
P50616 (TOB1) S152 Uniprot
P50616 (TOB1) S154 Uniprot
P50616 (TOB1) S164 Uniprot
P51168 (SCNN1B) T615 Uniprot
P51170 (SCNN1G) T622 Uniprot
P51812 (RPS6KA3) S227 Uniprot
P51812 (RPS6KA3) T577 Uniprot
P53004 (BLVRA) S230 Uniprot
P53355 (DAPK1) S734 Uniprot
P53805-4 (RCAN1) S32 Uniprot
P53805-2 (RCAN1) S112 Uniprot
P53805 (RCAN1) S167 Uniprot
P55211 (CASP9) T125 Uniprot
P56270 (MAZ) T72 Uniprot
P61586 (RHOA) S88 Uniprot
P61586 (RHOA) T100 Uniprot
P61978 (HNRNPK) S284 Uniprot
P61978 (HNRNPK) S353 Uniprot
P63000 (RAC1) T108 Uniprot
P68431 (HIST1H3J) S29 Uniprot
P78347-2 (GTF2I) S627 Uniprot
P78347-2 (GTF2I) S633 Uniprot
P78347 (GTF2I) S668 Uniprot
P78347 (GTF2I) S674 Uniprot
P78536 (ADAM17) T735 Uniprot
P84022 (SMAD3) S204 Uniprot
P84243 (H3F3B) S29 Uniprot
Q00613-1 (HSF1) S307 Uniprot
Q00975 (CACNA1B) S411 Uniprot
Q00975 (CACNA1B) S446 Uniprot
Q01196-8 (RUNX1) S276 Uniprot
Q01196-8 (RUNX1) S293 Uniprot
Q01196-8 (RUNX1) T300 Uniprot
Q01196-8 (RUNX1) S303 Uniprot
Q01196-8 (RUNX1) S462 Uniprot
Q01844 (EWSR1) T79 Uniprot
Q01860 (POU5F1) S111 Uniprot
Q01892 (SPIB) T56 Uniprot
Q02447 (SP3) S73 Uniprot
Q02641 (CACNB1) S161 Uniprot
Q02641 (CACNB1) S348 Uniprot
Q02750 (MAP2K1) T286 Uniprot
Q02750 (MAP2K1) T292 Uniprot
Q02750 (MAP2K1) T386 Uniprot
Q04637-8 (EIF4G1) S1232 Uniprot
Q05209 (PTPN12) S571 Uniprot
Q05397 (PTK2) S910 Uniprot
Q05469-1 (LIPE) T891 Uniprot
Q05682-4 (CALD1) S534 Uniprot
Q05682 (CALD1) S759 Uniprot
Q05682 (CALD1) S789 Uniprot
Q07812 (BAX) T167 Uniprot
Q07820 (MCL1) T92 Uniprot
Q07820 (MCL1) T163 Uniprot
Q07866 (KLC1) S460 Uniprot
Q07869-1 (PPARA) S12 Uniprot
Q07869-1 (PPARA) S21 Uniprot
Q07889 (SOS1) S1132 Uniprot
Q07889 (SOS1) S1167 Uniprot
Q07889 (SOS1) S1178 Uniprot
Q07889 (SOS1) S1193 Uniprot
Q08499-2 (PDE4D) S579 Uniprot
Q08499 (PDE4D) S715 Uniprot
Q09472 (EP300) S1038 Uniprot
Q09472 (EP300) S2039 Uniprot
Q12772 (SREBF2) S432 Uniprot
Q12772 (SREBF2) S455 Uniprot
Q12800 (TFCP2) S291 Uniprot
Q12800 (TFCP2) S309 Uniprot
Q12929 (EPS8) S625 Uniprot
Q12929 (EPS8) T629 Uniprot
Q13153 (PAK1) T292 Uniprot
Q13164 (MAPK7) T733 Uniprot
Q13322 (GRB10) S150 Uniprot
Q13322 (GRB10) S476 Uniprot
Q13362 (PPP2R5C) S337 Uniprot
Q13480-2 (GAB1) T312 Uniprot
Q13480-2 (GAB1) S381 Uniprot
Q13480-2 (GAB1) S454 Uniprot
Q13480-1 (GAB1) T476 Uniprot
Q13480-1 (GAB1) S551 Uniprot
Q13480-1 (GAB1) S567 Uniprot
Q13480-2 (GAB1) S581 Uniprot
Q13480-2 (GAB1) S597 Uniprot
Q13485 (SMAD4) T277 Uniprot
Q13522 (PPP1R1A) S67 Uniprot
Q13541 (EIF4EBP1) S65 Uniprot
Q13586 (STIM1) S575 Uniprot
Q13586 (STIM1) S608 Uniprot
Q13586 (STIM1) S621 Uniprot
Q13614 (MTMR2) S58 Uniprot
Q13950 (RUNX2) S24 Uniprot
Q13950 (RUNX2) S28 Uniprot
Q13950 (RUNX2) S43 Uniprot
Q13950 (RUNX2) S275 Uniprot
Q13950 (RUNX2) S294 Uniprot
Q13950 (RUNX2) S312 Uniprot
Q13950 (RUNX2) S314 Uniprot
Q13950 (RUNX2) S340 Uniprot
Q13950 (RUNX2) S503 Uniprot
Q14005 (IL16) S845 Uniprot
Q14160 (SCRIB) T553 Uniprot
Q14160 (SCRIB) S1448 Uniprot
Q14247 (CTTN) S405 Uniprot
Q14247 (CTTN) S418 Uniprot
Q14790 (CASP8) S387 Uniprot
Q14934 (NFATC4) S676 Uniprot
Q15046 (KARS) S207 Uniprot
Q15366 (PCBP2) S173 Uniprot
Q15366 (PCBP2) S189 Uniprot
Q15366 (PCBP2) T213 Uniprot
Q15366 (PCBP2) S272 Uniprot
Q15596 (NCOA2) S736 Uniprot
Q15648 (MED1) T1032 Uniprot
Q15648 (MED1) T1457 Uniprot
Q15672 (TWIST1) S68 Uniprot
Q15746 (MYLK) S1779 Uniprot
Q15788 (NCOA1) T1179 Uniprot
Q15788 (NCOA1) S1185 Uniprot
Q15796 (SMAD2) T8 Uniprot
Q15796 (SMAD2) T220 Uniprot
Q15796 (SMAD2) S245 Uniprot
Q15796 (SMAD2) S250 Uniprot
Q15796 (SMAD2) S255 Uniprot
Q15831 (STK11) S428 Uniprot
Q16204 (CCDC6) S244 Uniprot
Q16254 (E2F4) S244 Uniprot
Q16254 (E2F4) S384 Uniprot
Q16559 (TAL2) S100 Uniprot
Q16665 (HIF1A) S641 Uniprot
Q16665 (HIF1A) S643 Uniprot
Q16690 (DUSP5) T321 Uniprot
Q16690 (DUSP5) S346 Uniprot
Q16690 (DUSP5) S376 Uniprot
Q16828 (DUSP6) S159 Uniprot
Q16828 (DUSP6) S174 Uniprot
Q16828 (DUSP6) S197 Uniprot
Q16828 (DUSP6) S300 Uniprot
Q2M1Z3 (ARHGAP31) T789 Uniprot
Q86UC2 (RSPH3) T286 Uniprot
Q86UR1 (NOXA1) S282 Uniprot
Q86WB0 (ZC3HC1) S354 Uniprot
Q86WB0 (ZC3HC1) S359 Uniprot
Q8IX03 (WWC1) S542 Uniprot
Q8IX03 (WWC1) S548 Uniprot
Q8IZP0 (ABI1) S183 Uniprot
Q8IZP0 (ABI1) S216 Uniprot
Q8IZP0 (ABI1) S225 Uniprot
Q8IZP0 (ABI1) T265 Uniprot
Q8IZP0 (ABI1) S267 Uniprot
Q8IZP0 (ABI1) S392 Uniprot
Q8IZP0 (ABI1) T394 Uniprot
Q8IZP0 (ABI1) S410 Uniprot
Q8N122 (RPTOR) S8 Uniprot
Q8N122 (RPTOR) S696 Uniprot
Q8N122 (RPTOR) S863 Uniprot
Q8N9N5 (BANP) T337 Uniprot
Q8N9N5 (BANP) T352 Uniprot
Q8WX93 (PALLD) S688 Uniprot
Q8WX93 (PALLD) S808 Uniprot
Q92793 (CREBBP) S93 Uniprot
Q92908 (GATA6) S266 Uniprot
Q92934 (BAD) S75 Uniprot
Q92974-2 (ARHGEF2) T678 Uniprot
Q92974 (ARHGEF2) T679 Uniprot
Q92974-2 (ARHGEF2) S959 Uniprot
Q93045-1 (STMN2) S62 Uniprot
Q93045-1 (STMN2) S73 Uniprot
Q969H0 (FBXW7) T205 Uniprot
Q969V6 (MRTFA) S454 Uniprot
Q96FF9 (CDCA5) S79 Uniprot
Q96FF9 (CDCA5) S209 Uniprot
Q96Q27 (ASB2) S323 Uniprot
Q96RK0 (CIC) S1389 Uniprot
Q96RK0 (CIC) S1409 Uniprot
Q9BR01 (SULT4A1) T11 Uniprot
Q9BUB5 (MKNK1) T385 Uniprot
Q9BZI1 (IRX2) S317 Uniprot
Q9H8Y8 (GORASP2) T222 Uniprot
Q9H8Y8 (GORASP2) T225 Uniprot
Q9NQ66 (PLCB1) S982 Uniprot
Q9NRA0 (SPHK2) S387 Uniprot
Q9NRA0 (SPHK2) T614 Uniprot
Q9NRF2 (SH2B1) S96 Uniprot
Q9NYA1 (SPHK1) S225 Uniprot
Q9NYV6 (RRN3) S633 Uniprot
Q9NYV6 (RRN3) S649 Uniprot
Q9UBN7 (HDAC6) T1031 Uniprot
Q9UBN7 (HDAC6) S1035 Uniprot
Q9UHB6 (LIMA1) S362 Uniprot
Q9UHB6 (LIMA1) S604 Uniprot
Q9UIG0 (BAZ1B) S158 Uniprot
Q9UJY1 (HSPB8) S24 Uniprot
Q9UJY1 (HSPB8) S27 Uniprot
Q9UJY1 (HSPB8) T87 Uniprot
Q9UJY1 (HSPB8) S159 Uniprot
Q9UKX7 (NUP50) S221 Uniprot
Q9UKX7 (NUP50) S315 Uniprot
Q9ULC4 (MCTS1) T81 Uniprot
Q9UPT5 (EXOC7) S250 Uniprot
Q9UQC2 (GAB2) S623 Uniprot
Q9Y6W5 (WASF2) S343 Uniprot
Q9Y6W5 (WASF2) T346 Uniprot
Q9Y6W5 (WASF2) S351 Uniprot
Substrate Site Source
C9JLW8 (MCRIP1) S21 Uniprot
C9JLW8 (MCRIP1) T30 Uniprot
O00213 (APBB1) S175 Uniprot
O00213 (APBB1) S287 Uniprot
O00213 (APBB1) S347 Uniprot
O00213 (APBB1) T709 Uniprot
O00267 (SUPT5H) S666 Uniprot
O00429 (DNM1L) S616 Uniprot
O00562 (PITPNM1) T794 Uniprot
O00562 (PITPNM1) T1223 Uniprot
O14613 (CDC42EP2) S101 Uniprot
O43251 (RBFOX2) T7 Uniprot
O43294 (TGFB1I1) S141 Uniprot
O43521 (BCL2L11) S69 Uniprot
O43524 (FOXO3) S294 Uniprot
O43524 (FOXO3) S344 Uniprot
O43524 (FOXO3) S425 Uniprot
O43623 (SNAI2) S87 Uniprot
O43623 (SNAI2) S104 Uniprot
O60331 (PIP5K1C) S650 Uniprot
O60502 (OGA) T709 Uniprot
O60504-2 (SORBS3) S188 Uniprot
O60504 (SORBS3) S530 Uniprot
O60504 (SORBS3) T585 Uniprot
O60749 (SNX2) T104 Uniprot
O75030-9 (MITF) S73 Uniprot
O75030 (MITF) S180 Uniprot
O75151 (PHF2) S655 Uniprot
O75581 (LRP6) S1490 Uniprot
O75581 (LRP6) T1572 Uniprot
O75582 (RPS6KA5) S360 Uniprot
O75582-1 (RPS6KA5) S376 Uniprot
O75582 (RPS6KA5) T581 Uniprot
O75582 (RPS6KA5) T700 Uniprot
O94804 (STK10) T952 Uniprot
O94811 (TPPP) T14 Uniprot
O94811 (TPPP) S18 Uniprot
O94811 (TPPP) S160 Uniprot
O95785 (WIZ) S983 Uniprot
O95863 (SNAI1) S82 Uniprot
O95863 (SNAI1) S104 Uniprot
O95997 (PTTG1) S165 Uniprot
P00533 (EGFR) T693 Uniprot
P01100 (FOS) T232 Uniprot
P01100 (FOS) T325 Uniprot
P01100-1 (FOS) T331 Uniprot
P01100 (FOS) S374 Uniprot
P01106 (MYC) T58 Uniprot
P01106 (MYC) S62 Uniprot
P01106 (MYC) S71 Uniprot
P02545 (LMNA) S22 Uniprot
P02686-5 (MBP) T99 Uniprot
P02686-1 (MBP) T229 Uniprot
P02686 (MBP) T232 Uniprot
P03372 (ESR1) S104 Uniprot
P03372 (ESR1) S106 Uniprot
P03372 (ESR1) S118 Uniprot
P04049-1 (RAF1) S29 Uniprot
P04049-1 (RAF1) S289 Uniprot
P04049 (RAF1) S296 Uniprot
P04049-1 (RAF1) S301 Uniprot
P04049 (RAF1) S642 Uniprot
P04150-2 (NR3C1) S226 Uniprot
P04637-1 (TP53) S15 Uniprot
P04637 (TP53) T55 Uniprot
P05023 (ATP1A1) S16 Uniprot
P05198 (EIF2S1) S52 Uniprot
P05787-1 (KRT8) S74 Uniprot
P05787 (KRT8) T431 Uniprot
P06239 (LCK) S42 Uniprot
P06239 (LCK) S59 Uniprot
P06401 (PGR) S294 Uniprot
P07101-3 (TH) S31 Uniprot
P07101-2 (TH) S58 Uniprot
P07101 (TH) S62 Uniprot
P07196 (NEFL) T21 Uniprot
P08047 (SP1) S59 Uniprot
P08047-1 (SP1) T453 Uniprot
P08047 (SP1) T739 Uniprot
P09874 (PARP1) S372 Uniprot
P09874 (PARP1) T373 Uniprot
P09917 (ALOX5) S664 Uniprot
P10070 (GLI2) T903 Uniprot
P10242-1 (MYB) S532 Uniprot
P10275-1 (AR) S516 Uniprot
P10415 (BCL2) T56 Uniprot
P10415 (BCL2) S70 Uniprot
P10415 (BCL2) T74 Uniprot
P10415-1 (BCL2) S87 Uniprot
P10636-8 (MAPT) S46 Uniprot
P10636-8 (MAPT) T50 Uniprot
P10636-6 (MAPT) T117 Uniprot
P10636-2 (MAPT) T123 Uniprot
P10636-2 (MAPT) S144 Uniprot
P10636-8 (MAPT) T153 Uniprot
P10636-8 (MAPT) T175 Uniprot
P10636-8 (MAPT) T181 Uniprot
P10636-8 (MAPT) S199 Uniprot
P10636-8 (MAPT) S202 Uniprot
P10636-8 (MAPT) T205 Uniprot
P10636-8 (MAPT) T212 Uniprot
P10636-8 (MAPT) T217 Uniprot
P10636-8 (MAPT) T231 Uniprot
P10636-8 (MAPT) S235 Uniprot
P10636-8 (MAPT) S396 Uniprot
P10636-8 (MAPT) S404 Uniprot
P10636-8 (MAPT) S422 Uniprot
P10636 (MAPT) S519 Uniprot
P10636 (MAPT) T522 Uniprot
P10636 (MAPT) S721 Uniprot
P10646 (TFPI) S202 Uniprot
P10828 (THRB) S142 Uniprot
P11308 (ERG) S222 Uniprot
P11308 (ERG) S283 Uniprot
P11362 (FGFR1) S777 Uniprot
P11388 (TOP2A) S1213 Uniprot
P11388 (TOP2A) S1247 Uniprot
P11388 (TOP2A) S1354 Uniprot
P11388 (TOP2A) S1361 Uniprot
P11388 (TOP2A) S1393 Uniprot
P12036 (NEFH) S518 Uniprot
P12036 (NEFH) S526 Uniprot
P12036 (NEFH) S532 Uniprot
P12270 (TPR) T2116 Uniprot
P12270 (TPR) T2137 Uniprot
P12270 (TPR) S2155 Uniprot
P12270 (TPR) T2214 Uniprot
P12980 (LYL1) S36 Uniprot
P14543 (NID1) S333 Uniprot
P14598 (NCF1) S345 Uniprot
P14598 (NCF1) S348 Uniprot
P14618 (PKM) S37 Uniprot
P14635 (CCNB1) S126 Uniprot
P14635 (CCNB1) S128 Uniprot
P14784 (IL2RB) T476 Uniprot
P14921 (ETS1) T38 Uniprot
P15036 (ETS2) T72 Uniprot
P15056 (BRAF) S151 Uniprot
P15056 (BRAF) T401 Uniprot
P15056 (BRAF) S750 Uniprot
P15056 (BRAF) T753 Uniprot
P15336 (ATF2) T69 Uniprot
P15336 (ATF2) T71 Uniprot
P15336 (ATF2) S90 Uniprot
P15391-1 (CD19) Y348 Uniprot
P15391-1 (CD19) Y378 Uniprot
P15391-1 (CD19) Y409 Uniprot
P15391-1 (CD19) Y439 Uniprot
P15923-2 (TCF3) S352 Uniprot
P15923-2 (TCF3) T355 Uniprot
P15923-2 (TCF3) S359 Uniprot
P16220 (CREB1) S133 Uniprot
P16949 (STMN1) S25 Uniprot
P16949 (STMN1) S38 Uniprot
P17252 (PRKCA) T638 Uniprot
P17302 (GJA1) S255 Uniprot
P17302 (GJA1) S279 Uniprot
P17302 (GJA1) S282 Uniprot
P17480 (UBTF) T117 Uniprot
P17480 (UBTF) T201 Uniprot
P17535 (JUND) S100 Uniprot
P17655 (CAPN2) S50 Uniprot
P17676 (CEBPB) T235 Uniprot
P17861 (XBP1) S68 Uniprot
P17861 (XBP1) S181 Uniprot
P19419 (ELK1) S383 Uniprot
P19419 (ELK1) S389 Uniprot
P19438-1 (TNFRSF1A) S274 Uniprot
P19438-1 (TNFRSF1A) T280 Uniprot
P19484 (TFEB) S142 Uniprot
P19525 (EIF2AK2) T451 Uniprot
P19634 (SLC9A1) S693 Uniprot
P19634-1 (SLC9A1) S766 Uniprot
P19634 (SLC9A1) S770 Uniprot
P19634-1 (SLC9A1) T779 Uniprot
P19634-1 (SLC9A1) S785 Uniprot
P19793 (RXRA) S260 Uniprot
P19878 (NCF2) T233 Uniprot
P22736-1 (NR4A1) T143 Uniprot
P22736 (NR4A1) S431 Uniprot
P23396 (RPS3) T42 Uniprot
P23396 (RPS3) T221 Uniprot
P23443 (RPS6KB1) S434 Uniprot
P23443 (RPS6KB1) T444 Uniprot
P23443 (RPS6KB1) S447 Uniprot
P24046-1 (GABRR1) T394 Uniprot
P24046-1 (GABRR1) S435 Uniprot
P24046-1 (GABRR1) S440 Uniprot
P24928 (POLR2A) S1619 Uniprot
P24928 (POLR2A) S1626 Uniprot
P24928 (POLR2A) S1647 Uniprot
P24928 (POLR2A) S1654 Uniprot
P24928 (POLR2A) S1668 Uniprot
P24928 (POLR2A) S1675 Uniprot
P24928 (POLR2A) S1696 Uniprot
P24928 (POLR2A) S1717 Uniprot
P24928 (POLR2A) S1724 Uniprot
P24928 (POLR2A) S1738 Uniprot
P24928 (POLR2A) S1766 Uniprot
P24928 (POLR2A) S1787 Uniprot
P24928 (POLR2A) S1864 Uniprot
P24928 (POLR2A) S1871 Uniprot
P24928 (POLR2A) S1878 Uniprot
P24928 (POLR2A) S1892 Uniprot
P24928 (POLR2A) S1899 Uniprot
P24928 (POLR2A) S1913 Uniprot
P24928 (POLR2A) S1920 Uniprot
P24928 (POLR2A) S1927 Uniprot
P24928 (POLR2A) S1934 Uniprot
P24928 (POLR2A) S1944 Uniprot
P24928 (POLR2A) S1951 Uniprot
P24941 (CDK2) T160 Uniprot
P27708 (CAD) T456 Uniprot
P28482-1 (MAPK1) S41 Uniprot
P28482-1 (MAPK1) T185 Uniprot
P28482 (MAPK1) Y187 Uniprot
P28482 (MAPK1) T190 Uniprot
P28482 (MAPK1) S246 Uniprot
P28562 (DUSP1) S296 Uniprot
P28562 (DUSP1) S323 Uniprot
P28562 (DUSP1) S359 Uniprot
P28562 (DUSP1) S364 Uniprot
P29590-4 (PML) T28 Uniprot
P29590 (PML) S36 Uniprot
P29590 (PML) S38 Uniprot
P29590 (PML) S40 Uniprot
P29590 (PML) S527 Uniprot
P29590-4 (PML) S530 Uniprot
P30041 (PRDX6) T177 Uniprot
P30307 (CDC25C) S216 Uniprot
P31645 (SLC6A4) T616 Uniprot
P31749 (AKT1) S473 Uniprot
P31943 (HNRNPH1) S104 Uniprot
P32004 (L1CAM) S1204 Uniprot
P32004 (L1CAM) S1248 Uniprot
P32121 (ARRB2) S14 Uniprot
P32121 (ARRB2) T276 Uniprot
P33076 (CIITA) S280 Uniprot
P33076 (CIITA) S288 Uniprot
P33981 (TTK) S821 Uniprot
P35236 (PTPN7) T66 Uniprot
P35236 (PTPN7) S93 Uniprot
P35236-2 (PTPN7) T105 Uniprot
P35236-2 (PTPN7) S132 Uniprot
P35398-4 (RORA) T128 Uniprot
P35398 (RORA) T183 Uniprot
P35568 (IRS1) S312 Uniprot
P35568 (IRS1) S616 Uniprot
P35568 (IRS1) S636 Uniprot
P35568 (IRS1) S639 Uniprot
P35658 (NUP214) S1710 Uniprot
P35658 (NUP214) S1809 Uniprot
P36956-3 (SREBF1) T81 Uniprot
P36956-3 (SREBF1) S93 Uniprot
P36956 (SREBF1) S117 Uniprot
P36956-4 (SREBF1) S147 Uniprot
P37231-2 (PPARG) S84 Uniprot
P37231 (PPARG) S112 Uniprot
P38936 (CDKN1A) T57 Uniprot
P38936 (CDKN1A) S130 Uniprot
P40763-2 (STAT3) S726 Uniprot
P40763 (STAT3) S727 Uniprot
P41162 (ETV3) S139 Uniprot
P41182 (BCL6) S333 Uniprot
P41182 (BCL6) S343 Uniprot
P42224 (STAT1) S727 Uniprot
P42229 (STAT5A) S780 Uniprot
P42702-1 (LIFR) S1044 Uniprot
P43354 (NR4A2) S126 Uniprot
P43354 (NR4A2) T132 Uniprot
P43694 (GATA4) S105 Uniprot
P46527 (CDKN1B) S10 Uniprot
P46527 (CDKN1B) S178 Uniprot
P46527 (CDKN1B) T187 Uniprot
P46695 (IER3) T18 Uniprot
P46821 (MAP1B) S1785 Uniprot
P47712 (PLA2G4A) S505 Uniprot
P48634 (PRRC2A) T610 Uniprot
P48634 (PRRC2A) S1004 Uniprot
P48634 (PRRC2A) S1219 Uniprot
P49023-2 (PXN) S83 Uniprot
P49023-2 (PXN) S126 Uniprot
P49023-2 (PXN) S130 Uniprot
P49137 (MAPKAPK2) S9 Uniprot
P49137 (MAPKAPK2) T25 Uniprot
P49137 (MAPKAPK2) T222 Uniprot
P49137 (MAPKAPK2) S272 Uniprot
P49137 (MAPKAPK2) T334 Uniprot
P49137 (MAPKAPK2) T338 Uniprot
P49407-2 (ARRB1) S404 Uniprot
P49407 (ARRB1) S412 Uniprot
P49418 (AMPH) S293 Uniprot
P49418 (AMPH) S295 Uniprot
P49585 (PCYT1A) S315 Uniprot
P49715 (CEBPA) S21 Uniprot
P49790 (NUP153) S257 Uniprot
P49790 (NUP153) S320 Uniprot
P49790 (NUP153) S334 Uniprot
P49790 (NUP153) S338 Uniprot
P49790 (NUP153) T369 Uniprot
P49790 (NUP153) T388 Uniprot
P49790 (NUP153) T413 Uniprot
P49790 (NUP153) S516 Uniprot
P49790 (NUP153) S522 Uniprot
P49790 (NUP153) S529 Uniprot
P49790 (NUP153) S614 Uniprot
P49795 (RGS19) S151 Uniprot
P49815-1 (TSC2) S540 Uniprot
P49815-1 (TSC2) S664 Uniprot
P49841 (GSK3B) T43 Uniprot
P50548-1 (ERF) S161 Uniprot
P50548-1 (ERF) S246 Uniprot
P50548 (ERF) S251 Uniprot
P50548 (ERF) T526 Uniprot
P50616 (TOB1) S152 Uniprot
P50616 (TOB1) S154 Uniprot
P50616 (TOB1) S164 Uniprot
P51168 (SCNN1B) T615 Uniprot
P51170 (SCNN1G) T622 Uniprot
P51812 (RPS6KA3) S386 Uniprot
P51812 (RPS6KA3) Y488 Uniprot
P51812 (RPS6KA3) Y529 Uniprot
P52945 (PDX1) S61 Uniprot
P52945 (PDX1) S66 Uniprot
P53355-1 (DAPK1) S734 Uniprot
P53805 (RCAN1) S167 Uniprot
P55211 (CASP9) T125 Uniprot
P61978 (HNRNPK) S284 Uniprot
P68400 (CSNK2A1) T360 Uniprot
P68400 (CSNK2A1) S362 Uniprot
P68431 (HIST1H3J) S29 Uniprot
P78347-2 (GTF2I) S627 Uniprot
P78347-2 (GTF2I) S633 Uniprot
P78347 (GTF2I) S668 Uniprot
P78347 (GTF2I) S674 Uniprot
P78352 (DLG4) T287 Uniprot
P78536 (ADAM17) T735 Uniprot
P78559 (MAP1A) T2042 Uniprot
P78559 (MAP1A) S2419 Uniprot
P84022 (SMAD3) T179 Uniprot
P84022 (SMAD3) S204 Uniprot
P84022 (SMAD3) S208 Uniprot
P84022-1 (SMAD3) S213 Uniprot
P84243 (H3F3B) S29 Uniprot
Q00587 (CDC42EP1) S113 Uniprot
Q00587 (CDC42EP1) S195 Uniprot
Q00613 (HSF1) S307 Uniprot
Q00975 (CACNA1B) S411 Uniprot
Q00975 (CACNA1B) S446 Uniprot
Q01196 (RUNX1) S249 Uniprot
Q01196 (RUNX1) S266 Uniprot
Q01196 (RUNX1) T273 Uniprot
Q01196-8 (RUNX1) S276 Uniprot
Q01196-8 (RUNX1) S293 Uniprot
Q01196-8 (RUNX1) T300 Uniprot
Q01196-8 (RUNX1) S303 Uniprot
Q01196-8 (RUNX1) S462 Uniprot
Q01844 (EWSR1) T79 Uniprot
Q01860 (POU5F1) S111 Uniprot
Q01860 (POU5F1) T118 Uniprot
Q01860 (POU5F1) S355 Uniprot
Q01959 (SLC6A3) S53 Uniprot
Q02224 (CENPE) S2605 Uniprot
Q02224 (CENPE) S2608 Uniprot
Q02224 (CENPE) S2639 Uniprot
Q02224 (CENPE) S2654 Uniprot
Q02447 (SP3) S73 Uniprot
Q02641 (CACNB1) S161 Uniprot
Q02641 (CACNB1) S348 Uniprot
Q02750 (MAP2K1) T286 Uniprot
Q02750 (MAP2K1) T292 Uniprot
Q02750 (MAP2K1) T386 Uniprot
Q02952 (AKAP12) S286 Uniprot
Q04206 (RELA) T435 Uniprot
Q04637-8 (EIF4G1) S1232 Uniprot
Q05209 (PTPN12) S571 Uniprot
Q05397 (PTK2) S910 Uniprot
Q05469-1 (LIPE) T891 Uniprot
Q05682-4 (CALD1) S534 Uniprot
Q05682 (CALD1) S759 Uniprot
Q05682 (CALD1) S789 Uniprot
Q07343-2 (PDE4B) S487 Uniprot
Q07343 (PDE4B) S659 Uniprot
Q07666 (KHDRBS1) S58 Uniprot
Q07666 (KHDRBS1) T72 Uniprot
Q07666-1 (KHDRBS1) T84 Uniprot
Q07812 (BAX) T167 Uniprot
Q07820 (MCL1) T163 Uniprot
Q07866 (KLC1) S460 Uniprot
Q07869-1 (PPARA) S12 Uniprot
Q07869 (PPARA) S21 Uniprot
Q07889 (SOS1) S1132 Uniprot
Q07889-1 (SOS1) S1167 Uniprot
Q07889-1 (SOS1) S1178 Uniprot
Q07889 (SOS1) S1193 Uniprot
Q07889-1 (SOS1) S1197 Uniprot
Q08493-2 (PDE4C) S535 Uniprot
Q08493 (PDE4C) S641 Uniprot
Q08499-5 (PDE4D) S413 Uniprot
Q08499-4 (PDE4D) S490 Uniprot
Q08499-2 (PDE4D) S579 Uniprot
Q08499 (PDE4D) S715 Uniprot
Q09472 (EP300) T317 Uniprot
Q09472 (EP300) T938 Uniprot
Q09472 (EP300) S1038 Uniprot
Q09472 (EP300) T1960 Uniprot
Q09472 (EP300) S2039 Uniprot
Q09472 (EP300) S2279 Uniprot
Q09472 (EP300) S2315 Uniprot
Q09472 (EP300) S2366 Uniprot
Q09666 (AHNAK) S216 Uniprot
Q09666 (AHNAK) T694 Uniprot
Q09666 (AHNAK) S5099 Uniprot
Q09666 (AHNAK) S5110 Uniprot
Q09666 (AHNAK) T5794 Uniprot
Q12772 (SREBF2) S432 Uniprot
Q12772 (SREBF2) S455 Uniprot
Q12778 (FOXO1) S246 Uniprot
Q12778 (FOXO1) S413 Uniprot
Q12778 (FOXO1) S418 Uniprot
Q12778 (FOXO1) S429 Uniprot
Q12778 (FOXO1) S470 Uniprot
Q12778 (FOXO1) T478 Uniprot
Q12778 (FOXO1) T560 Uniprot
Q12800 (TFCP2) S291 Uniprot
Q12800 (TFCP2) S309 Uniprot
Q13153 (PAK1) T212 Uniprot
Q13164 (MAPK7) T733 Uniprot
Q13285 (NR5A1) S203 Uniprot
Q13322-3 (GRB10) S92 Uniprot
Q13322 (GRB10) S150 Uniprot
Q13322-3 (GRB10) S360 Uniprot
Q13322-2 (GRB10) S372 Uniprot
Q13322 (GRB10) S418 Uniprot
Q13322-2 (GRB10) S430 Uniprot
Q13322 (GRB10) S476 Uniprot
Q13362 (PPP2R5C) S337 Uniprot
Q13409 (DYNC1I2) S87 Uniprot
Q13459 (MYO9B) T1346 Uniprot
Q13480-1 (GAB1) T312 Uniprot
Q13480-2 (GAB1) S381 Uniprot
Q13480 (GAB1) S454 Uniprot
Q13480 (GAB1) T476 Uniprot
Q13480-1 (GAB1) S551 Uniprot
Q13480-1 (GAB1) S567 Uniprot
Q13480-2 (GAB1) S581 Uniprot
Q13480 (GAB1) S582 Uniprot
Q13480-2 (GAB1) S597 Uniprot
Q13485 (SMAD4) T277 Uniprot
Q13541 (EIF4EBP1) T37 Uniprot
Q13541 (EIF4EBP1) T45 Uniprot
Q13541 (EIF4EBP1) T46 Uniprot
Q13541 (EIF4EBP1) S65 Uniprot
Q13541 (EIF4EBP1) T70 Uniprot
Q13541 (EIF4EBP1) S83 Uniprot
Q13562 (NEUROD1) S162 Uniprot
Q13562 (NEUROD1) S259 Uniprot
Q13562 (NEUROD1) S266 Uniprot
Q13562 (NEUROD1) S274 Uniprot
Q13586 (STIM1) S575 Uniprot
Q13586 (STIM1) S608 Uniprot
Q13586 (STIM1) S621 Uniprot
Q13614 (MTMR2) S58 Uniprot
Q13625 (TP53BP2) T586 Uniprot
Q13625 (TP53BP2) S827 Uniprot
Q14005 (IL16) S845 Uniprot
Q14151 (SAFB2) S343 Uniprot
Q14157-1 (UBAP2L) T844 Uniprot
Q14185 (DOCK1) T1772 Uniprot
Q14247 (CTTN) S405 Uniprot
Q14247 (CTTN) S418 Uniprot
Q14643 (ITPR1) S436 Uniprot
Q14643 (ITPR1) S1774 Uniprot
Q14654 (KCNJ11) T341 Uniprot
Q14654 (KCNJ11) S385 Uniprot
Q14674 (ESPL1) S1126 Uniprot
Q14686 (NCOA6) S884 Uniprot
Q14790 (CASP8) S387 Uniprot
Q14934 (NFATC4) S676 Uniprot
Q15366 (PCBP2) S173 Uniprot
Q15366 (PCBP2) S189 Uniprot
Q15366 (PCBP2) T213 Uniprot
Q15366 (PCBP2) S272 Uniprot
Q15398 (DLGAP5) T329 Uniprot
Q15418-1 (RPS6KA1) T359 Uniprot
Q15418-1 (RPS6KA1) S363 Uniprot
Q15418-2 (RPS6KA1) T368 Uniprot
Q15418-2 (RPS6KA1) S372 Uniprot
Q15418 (RPS6KA1) T573 Uniprot
Q15596 (NCOA2) S736 Uniprot
Q15648 (MED1) T1032 Uniprot
Q15648 (MED1) T1457 Uniprot
Q15672 (TWIST1) S6 Uniprot
Q15672 (TWIST1) S68 Uniprot
Q15700 (DLG2) S323 Uniprot
Q15746 (MYLK) S1779 Uniprot
Q15788-3 (NCOA1) S395 Uniprot
Q15788-2 (NCOA1) T1179 Uniprot
Q15788 (NCOA1) S1185 Uniprot
Q15796 (SMAD2) T220 Uniprot
Q15796 (SMAD2) S245 Uniprot
Q15796 (SMAD2) S250 Uniprot
Q15796 (SMAD2) S255 Uniprot
Q15797 (SMAD1) S187 Uniprot
Q15797 (SMAD1) S195 Uniprot
Q15797-1 (SMAD1) S206 Uniprot
Q15797 (SMAD1) S214 Uniprot
Q15831 (STK11) S428 Uniprot
Q16526 (CRY1) S247 Uniprot
Q16665 (HIF1A) S641 Uniprot
Q16665 (HIF1A) S643 Uniprot
Q16690 (DUSP5) T321 Uniprot
Q16690 (DUSP5) S346 Uniprot
Q16690 (DUSP5) S376 Uniprot
Q16828 (DUSP6) S159 Uniprot
Q16828 (DUSP6) S197 Uniprot
Q49AN0 (CRY2) S266 Uniprot
Q53EZ4 (CEP55) S425 Uniprot
Q53EZ4 (CEP55) S428 Uniprot
Q5SW79 (CEP170) T565 Uniprot
Q5VZ89 (DENND4C) S989 Uniprot
Q6P0Q8 (MAST2) S1337 Uniprot
Q6P996 (PDXDC1) T691 Uniprot
Q6PKG0 (LARP1) T303 Uniprot
Q6PKG0 (LARP1) S774 Uniprot
Q6Y7W6 (GIGYF2) S30 Uniprot
Q6ZS17 (RIPOR1) S351 Uniprot
Q70E73 (RAPH1) S610 Uniprot
Q7L5N1 (COPS6) S148 Uniprot
Q7LDG7 (RASGRP2) S394 Uniprot
Q7Z5J4 (RAI1) T1068 Uniprot
Q86UC2 (RSPH3) T286 Uniprot
Q86UR1 (NOXA1) S239 Uniprot
Q86UR1 (NOXA1) S282 Uniprot
Q86UU1 (PHLDB1) S443 Uniprot
Q86UU1 (PHLDB1) S461 Uniprot
Q86WB0 (ZC3HC1) S354 Uniprot
Q86WB0 (ZC3HC1) S359 Uniprot
Q8IUW5 (RELL1) T261 Uniprot
Q8IUX7 (AEBP1) T621 Uniprot
Q8IUX7 (AEBP1) T1012 Uniprot
Q8IVF2 (AHNAK2) T510 Uniprot
Q8IVT5-4 (KSR1) T137 Uniprot
Q8IVT5-4 (KSR1) T151 Uniprot
Q8IVT5-4 (KSR1) S320 Uniprot
Q8IW41 (MAPKAPK5) T182 Uniprot
Q8IX03 (WWC1) S542 Uniprot
Q8IX03 (WWC1) S548 Uniprot
Q8IYB8 (SUPV3L1) S725 Uniprot
Q8IZP0 (ABI1) S183 Uniprot
Q8IZP0 (ABI1) S216 Uniprot
Q8IZP0 (ABI1) S222 Uniprot
Q8IZP0 (ABI1) S225 Uniprot
Q8IZP0 (ABI1) T265 Uniprot
Q8IZP0 (ABI1) S267 Uniprot
Q8IZP0 (ABI1) S392 Uniprot
Q8IZP0 (ABI1) T394 Uniprot
Q8IZP0 (ABI1) S410 Uniprot
Q8IZQ8 (MYOCD) S815 Uniprot
Q8IZQ8 (MYOCD) S862 Uniprot
Q8IZQ8 (MYOCD) S869 Uniprot
Q8IZQ8 (MYOCD) T896 Uniprot
Q8N122 (RPTOR) S8 Uniprot
Q8N122 (RPTOR) S696 Uniprot
Q8N122 (RPTOR) S863 Uniprot
Q8N1G1 (REXO1) T269 Uniprot
Q8N9N5 (BANP) T337 Uniprot
Q8N9N5 (BANP) T352 Uniprot
Q8NEL9 (DDHD1) S727 Uniprot
Q8NHW3 (MAFA) S14 Uniprot
Q8NHW3 (MAFA) S65 Uniprot
Q8TDM6 (DLG5) T1279 Uniprot
Q8TER0 (SNED1) T1239 Uniprot
Q8WX93 (PALLD) S688 Uniprot
Q8WX93 (PALLD) S808 Uniprot
Q92731 (ESR2) S105 Uniprot
Q92793 (CREBBP) S93 Uniprot
Q92908 (GATA6) S266 Uniprot
Q92934 (BAD) S75 Uniprot
Q92974 (ARHGEF2) T679 Uniprot
Q93062 (RBPMS) T118 Uniprot
Q969H0 (FBXW7) T205 Uniprot
Q969V6 (MRTFA) S454 Uniprot
Q96BY7 (ATG2B) T398 Uniprot
Q96EP5 (DAZAP1) T269 Uniprot
Q96EP5 (DAZAP1) T315 Uniprot
Q96FF9 (CDCA5) S79 Uniprot
Q96FF9 (CDCA5) S209 Uniprot
Q96I25 (RBM17) T71 Uniprot
Q96I25 (RBM17) S222 Uniprot
Q96LC9 (BMF) S74 Uniprot
Q96LC9 (BMF) S77 Uniprot
Q96LL9 (DNAJC30) S137 Uniprot
Q96PE2 (ARHGEF17) T702 Uniprot
Q96PH1-4 (NOX5) S498 Uniprot
Q96PH1 (NOX5) S544 Uniprot
Q96Q27 (ASB2) S323 Uniprot
Q96RK0 (CIC) S1389 Uniprot
Q96RK0 (CIC) S1409 Uniprot
Q96RS0 (TGS1) S298 Uniprot
Q96SB3 (PPP1R9B) S15 Uniprot
Q9BQG0 (MYBBP1A) S1267 Uniprot
Q9BQQ3 (GORASP1) S274 Uniprot
Q9BUB5 (MKNK1) T255 Uniprot
Q9BWW4 (SSBP3) T360 Uniprot
Q9BY84-1 (DUSP16) S446 Uniprot
Q9BZI1 (IRX2) S46 Uniprot
Q9BZI1 (IRX2) S64 Uniprot
Q9C0C2 (TNKS1BP1) T131 Uniprot
Q9C0C2 (TNKS1BP1) T1032 Uniprot
Q9C0D5 (TANC1) S1564 Uniprot
Q9GZM8 (NDEL1) T219 Uniprot
Q9GZM8 (NDEL1) T245 Uniprot
Q9H0D6 (XRN2) T439 Uniprot
Q9H8Y8 (GORASP2) T222 Uniprot
Q9H8Y8 (GORASP2) T225 Uniprot
Q9H9S0 (NANOG) S52 Uniprot
Q9H9S0 (NANOG) S71 Uniprot
Q9H9S0 (NANOG) T78 Uniprot
Q9HBH9 (MKNK2) S43 Uniprot
Q9HBH9 (MKNK2) S74 Uniprot
Q9HBH9 (MKNK2) S220 Uniprot
Q9HBH9 (MKNK2) T379 Uniprot
Q9HBH9 (MKNK2) S440 Uniprot
Q9HBH9 (MKNK2) S452 Uniprot
Q9NQ66 (PLCB1) S982 Uniprot
Q9NQC3 (RTN4) T172 Uniprot
Q9NRA0 (SPHK2) S387 Uniprot
Q9NRA0 (SPHK2) T614 Uniprot
Q9NRA8 (EIF4ENIF1) S115 Uniprot
Q9NRF2 (SH2B1) S96 Uniprot
Q9NSI2 (FAM207A) S39 Uniprot
Q9NUY8 (TBC1D23) T514 Uniprot
Q9NXR1 (NDE1) T215 Uniprot
Q9NXR1 (NDE1) S239 Uniprot
Q9NYA1 (SPHK1) S225 Uniprot
Q9NYZ3 (GTSE1) S461 Uniprot
Q9NZ72 (STMN3) S68 Uniprot
Q9NZV8 (KCND2) T602 Uniprot
Q9NZV8 (KCND2) T607 Uniprot
Q9NZV8 (KCND2) S616 Uniprot
Q9P0K7 (RAI14) T249 Uniprot
Q9UBN7 (HDAC6) T1031 Uniprot
Q9UHB6 (LIMA1) S362 Uniprot
Q9UHB6 (LIMA1) S604 Uniprot
Q9UKX7 (NUP50) S221 Uniprot
Q9UKX7 (NUP50) S315 Uniprot
Q9ULC4 (MCTS1) T81 Uniprot
Q9ULW0 (TPX2) T369 Uniprot
Q9UNA1 (ARHGAP26) S685 Uniprot
Q9UPT5 (EXOC7) S250 Uniprot
Q9UQC2 (GAB2) S623 Uniprot
Q9Y463 (DYRK1B) S421 Uniprot
Q9Y4F5 (CEP170B) S969 Uniprot
Q9Y4H2 (IRS2) T657 Uniprot
Q9Y4K1 (CRYBG1) S675 Uniprot
Q9Y698 (CACNG2) T321 Uniprot
Q9Y6G9 (DYNC1LI1) S516 Uniprot
Q9Y6W5 (WASF2) S296 Uniprot
Q9Y6W5 (WASF2) S308 Uniprot

研究背景

機能:

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DCC, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Mediates phosphorylation of TPR in respons to EGF stimulation. May play a role in the spindle assembly checkpoint. Phosphorylates PML and promotes its interaction with PIN1, leading to PML degradation. Phosphorylates CDK2AP2 (By similarity).

Acts as a transcriptional repressor. Binds to a [GC]AAA[GC] consensus sequence. Repress the expression of interferon gamma-induced genes. Seems to bind to the promoter of CCL5, DMP1, IFIH1, IFITM1, IRF7, IRF9, LAMP3, OAS1, OAS2, OAS3 and STAT1. Transcriptional activity is independent of kinase activity.

PTMs:

Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-185 and Tyr-187, which activates the enzyme. Undergoes regulatory phosphorylation on additional residues such as Ser-246 and Ser-248 in the kinase insert domain (KID) These phosphorylations, which are probably mediated by more than one kinase, are important for binding of MAPK1/ERK2 to importin-7 (IPO7) and its nuclear translocation. In addition, autophosphorylation of Thr-190 was shown to affect the subcellular localization of MAPK1/ERK2 as well. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-187. Phosphorylation on Ser-29 by SGK1 results in its activation by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. DUSP3 and DUSP6 dephosphorylate specifically MAPK1/ERK2 and MAPK3/ERK1 whereas DUSP9 dephosphorylates a broader range of MAPKs. Dephosphorylated by DUSP1 at Thr-185 and Tyr-187.

ISGylated.

細胞の位置付け:

Cytoplasm>Cytoskeleton>Spindle. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm. Membrane>Caveola.
Note: Associated with the spindle during prometaphase and metaphase (By similarity). PEA15-binding and phosphorylated DAPK1 promote its cytoplasmic retention. Phosphorylation at Ser- 246 and Ser-248 as well as autophosphorylation at Thr-190 promote nuclear localization.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
サブユニット構造:

Binds both upstream activators and downstream substrates in multimolecular complexes. This interaction inhibits its tyrosine-kinase activity. Interacts with ADAM15, ARHGEF2, ARRB2, DAPK1 (via death domain), HSF4, IER3, IPO7, DUSP6, NISCH, SGK1, and isoform 1 of NEK2. Interacts (phosphorylated form) with CAV2 ('Tyr-19'-phosphorylated form); the interaction, promoted by insulin, leads to nuclear location and MAPK1 activation. Interacts with MORG1, PEA15 and MKNK2 (By similarity). MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation (By similarity). Interacts with DCC (By similarity). The phosphorylated form interacts with PML (isoform PML-4). Interacts with STYX. Interacts with CDK2AP2. Interacts with CAVIN4 (By similarity). Interacts with DUSP7; the interaction enhances DUSP7 phosphatase activity.

(Microbial infection) Interacts with HIV-1 Nef through its SH3 domain.

タンパク質ファミリー:

The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.

機能:

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade.

PTMs:

Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-204.

細胞の位置付け:

Cytoplasm. Nucleus. Membrane>Caveola.
Note: Autophosphorylation at Thr-207 promotes nuclear localization.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
サブユニット構造:

Binds both upstream activators and downstream substrates in multimolecular complexes. Found in a complex with at least BRAF, HRAS, MAP2K1/MEK1, MAPK3 and RGS14 (By similarity). Interacts with ADAM15, ARRB2, CANX, DAPK1 (via death domain), HSF4, IER3, MAP2K1/MEK1, MORG1, NISCH, and SGK1. Interacts with PEA15 and MKNK2 (By similarity). MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation (By similarity). Interacts with TPR. Interacts with CDKN2AIP. Interacts with HSF1 (via D domain and preferentially with hyperphosphorylated form); this interaction occurs upon heat shock. Interacts with CAVIN4 (By similarity).

(Microbial infection) Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine-kinase activity.

タンパク質ファミリー:

The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.

研究領域

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Cellular Processes > Transport and catabolism > Autophagy - animal.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Adherens junction.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.   (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > ErbB signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Apelin signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Substance dependence > Alcoholism.

· Human Diseases > Infectious diseases: Bacterial > Shigellosis.

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Colorectal cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Renal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Endometrial cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Thyroid cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Acute myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Development > Axon guidance.   (View pathway)

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > B cell receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

· Organismal Systems > Environmental adaptation > Circadian entrainment.

· Organismal Systems > Nervous system > Long-term potentiation.

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.   (View pathway)

· Organismal Systems > Nervous system > Glutamatergic synapse.

· Organismal Systems > Nervous system > Cholinergic synapse.

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Nervous system > Long-term depression.

· Organismal Systems > Endocrine system > Insulin signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Melanogenesis.

· Organismal Systems > Endocrine system > Prolactin signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Oxytocin signaling pathway.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.