PPAP2A Antibody - #DF14024
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
折りたたみ/展開
Lipid phosphate phosphohydrolase 1; Lipid phosphate phosphohydrolase 1a; LLP1a; LPP1; LPP1_HUMAN; PAP 2a; PAP-2a; PAP2; PAP2-alpha; PAP2a; PAP2a2; PAP2alpha2; PAPalpha1; Phosphatidate phosphohydrolase type 2a; Phosphatidic acid phosphatase 2a; Phosphatidic acid phosphatase type 2A; Phosphatidic acid phosphohydrolase type 2a; PPAP2A; Type 2 phosphatidic acid phosphatase alpha; Type 2 phosphatidic acid phosphohydrolase;
免疫原
A synthesized peptide derived from Human PPAP2A.
Widely expressed with highest expression found in prostate (PubMed:9305923). Found to be down-regulated in colon adenocarcinomas (PubMed:9570154).
Predominant in kidney, lung, placenta and liver.
Predominant in heart and pancreas.
- O14494 PLPP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
研究背景
Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosphate/DGPP, sphingosine 1-phosphate/S1P and ceramide 1-phosphate/C1P. Also acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound. Through its extracellular phosphatase activity allows both the hydrolysis and the cellular uptake of these bioactive lipid mediators from the milieu, regulating signal transduction in different cellular processes. It is for instance essential for the extracellular hydrolysis of S1P and subsequent conversion into intracellular S1P. Involved in the regulation of inflammation, platelets activation, cell proliferation and migration among other processes. May also have an intracellular activity to regulate phospholipid-mediated signaling pathways (By similarity).
N-glycosylated. N-linked sugars are of the complex type. N-glycosylation is not required for the phosphatase activity (By similarity).
Cell membrane>Multi-pass membrane protein. Apical cell membrane>Multi-pass membrane protein. Membrane raft>Multi-pass membrane protein. Membrane>Caveola>Multi-pass membrane protein.
Widely expressed with highest expression found in prostate. Found to be down-regulated in colon adenocarcinomas.
Predominant in kidney, lung, placenta and liver.
Predominant in heart and pancreas.
Belongs to the PA-phosphatase related phosphoesterase family.
研究領域
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Choline metabolism in cancer. (View pathway)
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
· Metabolism > Lipid metabolism > Ether lipid metabolism.
· Metabolism > Lipid metabolism > Sphingolipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis. (View pathway)
· Organismal Systems > Digestive system > Fat digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.