HDAC1 Antibody - #AF6433
(5)
(4)
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# AF6433, RRID:AB_2835258.
折りたたみ／展開
DKFZp686H12203; GON 10; HD1; HDAC 1; HDAC1; HDAC1_HUMAN; Histone deacetylase 1; Reduced potassium dependency yeast homolog like 1; RPD3; RPD3L1;
免疫原
Ubiquitous, with higher levels in heart, pancreas and testis, and lower levels in kidney and brain.
- Q13547 HDAC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13547 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K10 | Ubiquitination | Uniprot | |
| K31 | Ubiquitination | Uniprot | |
| R36 | Methylation | Uniprot | |
| T38 | Phosphorylation | Uniprot | |
| Y45 | Phosphorylation | Uniprot | |
| Y48 | Phosphorylation | Uniprot | |
| K50 | Ubiquitination | Uniprot | |
| K58 | Ubiquitination | Uniprot | |
| K66 | Ubiquitination | Uniprot | |
| Y72 | Phosphorylation | Uniprot | |
| K74 | Acetylation | Uniprot | |
| K74 | Ubiquitination | Uniprot | |
| Y87 | Phosphorylation | Uniprot | |
| S88 | Phosphorylation | Uniprot | |
| K89 | Acetylation | Uniprot | |
| K89 | Methylation | Uniprot | |
| K89 | Sumoylation | Uniprot | |
| K89 | Ubiquitination | Uniprot | |
| K126 | Ubiquitination | Uniprot | |
| K143 | Ubiquitination | Uniprot | |
| K200 | Ubiquitination | Uniprot | |
| Y204 | Phosphorylation | Uniprot | |
| K218 | Acetylation | Uniprot | |
| K218 | Ubiquitination | Uniprot | |
| K220 | Acetylation | Uniprot | |
| K220 | Ubiquitination | Uniprot | |
| Y221 | Phosphorylation | Uniprot | |
| Y222 | Phosphorylation | Uniprot | |
| Y226 | Phosphorylation | Uniprot | |
| Y237 | Phosphorylation | Uniprot | |
| K242 | Ubiquitination | Uniprot | |
| K279 | Ubiquitination | Uniprot | |
| K283 | Ubiquitination | Uniprot | |
| S290 | Phosphorylation | Uniprot | |
| Y333 | Phosphorylation | Uniprot | |
| Y336 | Phosphorylation | Uniprot | |
| K342 | Sumoylation | Uniprot | |
| Y358 | Phosphorylation | Uniprot | |
| K361 | Ubiquitination | Uniprot | |
| K363 | Ubiquitination | Uniprot | |
| R365 | Methylation | Uniprot | |
| S393 | Phosphorylation | Uniprot | |
| S406 | Phosphorylation | Uniprot | |
| S409 | Phosphorylation | Uniprot | |
| S410 | Phosphorylation | Uniprot | |
| K412 | Acetylation | Uniprot | |
| K412 | Ubiquitination | Uniprot | |
| S421 | Phosphorylation | P68400 (CSNK2A1) , P19784 (CSNK2A2) | Uniprot |
| S423 | Phosphorylation | P68400 (CSNK2A1) , P19784 (CSNK2A2) | Uniprot |
| K432 | Acetylation | Uniprot | |
| K432 | Methylation | Uniprot | |
| S434 | Phosphorylation | Uniprot | |
| S435 | Phosphorylation | Uniprot | |
| K438 | Acetylation | Uniprot | |
| K439 | Acetylation | Uniprot | |
| K441 | Acetylation | Uniprot | |
| K444 | Sumoylation | Uniprot | |
| T445 | Phosphorylation | Uniprot | |
| K457 | Sumoylation | Uniprot | |
| K476 | Sumoylation | Uniprot | |
| K480 | Ubiquitination | Uniprot |
研究背景
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.
Sumoylated on Lys-444 and Lys-476; which promotes enzymatic activity. Desumoylated by SENP1.
Phosphorylation on Ser-421 and Ser-423 promotes enzymatic activity and interactions with NuRD and SIN3 complexes. Phosphorylated by CDK5.
Ubiquitinated by CHFR, leading to its degradation by the proteasome. Ubiquitinated by KCTD11, leading to proteasomal degradation.
Nucleus.
Ubiquitous, with higher levels in heart, pancreas and testis, and lower levels in kidney and brain.
Part of the core histone deacetylase (HDAC) complex composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core complex associates with MTA2, MBD2, MBD3, MTA1L1, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylation (NuRD) complex, or with SIN3, SAP18 and SAP30 to form the SIN3 HDAC complex. Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Found in a trimeric complex with APBB1 and TSHZ3; the interaction between HDAC1 and APBB1 is mediated by TSHZ3. Component of a RCOR/GFI/KDM1A/HDAC complex. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2. The large PER complex involved in the histone deacetylation is composed of at least HDAC1, PER2, SFPQ and SIN3A. Associates with the 9-1-1 complex; interacts with HUS1. Found in a complex with DNMT3A and HDAC7. Interacts with the non-histone region of MACROH2A1. Interacts with TRIM28; the interaction recruits HDAC1 to E2F1 and inhibits its acetylation. Interacts with SP1; the interaction deacetylates SP1 and regulates its transcriptional activity. Interacts with SP3; the interaction deacetylates SP3 and regulates its transcriptional activity. In vitro, C(18) ceramides increase this interaction and the subsequent SP3 deacetylation and SP3-mediated repression of the TERT promoter. Interacts with TSHZ3 (via N-terminus); the interaction is direct. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with C10orf90/FATS (via its N-terminal); the interaction prevents binding of HDAC1 to CDKN1A/p21 and facilitates the acetylation and stabilization of CDKN1A/p21. Interacts with CDKN1A/p21. Interacts with CDK5 complexed to CDK5R1 (p25). Interacts directly with GFI1 and GFI1B. Interacts with NR1D2 (via C-terminus). Interacts with TSC22D3 isoform 1; this interaction affects HDAC1 activity on MYOG promoter and thus inhibits MYOD1 transcriptional activity. Interacts with BAZ2A/TIP5, BANP, BCL6, BCOR, BHLHE40/DEC1, BRMS1, BRMS1L, CBFA2T3, CHFR, CIART, CRY1, DAXX, DDIT3/CHOP, DDX5, DNMT1, E4F1, EP300, HCFC1, HDAC9, INSM1, NFE4, NR4A2/NURR1, MIER1, KDM4A, KDM5B, KLF1, MINT, NRIP1, PCAF, PHB2, PRDM6, PRDM16, RB1, RERE, SAMSN1, SAP30L, SETDB1, SMAD3, SMARCA4/BRG1, SMYD2, SUV39H1, TGIF, TGIF2, TRAF6, UHRF1, UHRF2, ZMYND15, ZNF431 and ZNF541. Interacts with KDM5A (By similarity). Interacts with DNTTIP1. Identified in a histone deacetylase complex that contains DNTTIP1, HDAC1 and MIDEAS; this complex assembles into a tetramer that contains four copies of each protein chain. Interacts with CCAR2. Interacts with PPHLN1. Found in a complex with YY1, SIN3A and GON4L (By similarity). Interacts with CHD4. Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1. Interacts with SIN3A (By similarity). Interacts with DHX36; this interaction occurs in a RNA-dependent manner. Interacts with ZBTB7A. Interacts with SMAD4; positively regulated by ZBTB7A. Interacts with PACS2. Forms a complex comprising APPL1, RUVBL2, APPL2, CTNNB1 and HDAC2. Interacts with ZNF638. Interacts with SPHK2. Interacts with ERCC6.
Belongs to the histone deacetylase family. HD type 1 subfamily.
研究領域
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Environmental Information Processing > Signal transduction > Notch signaling pathway. (View pathway)
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia. (View pathway)
· Organismal Systems > Aging > Longevity regulating pathway - multiple species. (View pathway)
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
参考文献
Application: WB Species: mice Sample: cortex and hippocampus
Application: WB Species: Human Sample: MM cells
Application: WB Species: Human Sample: AS fibroblasts
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.