AFfirm™ hnRNP A1 Mouse Monoclonal Antibody - #BF8054
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
折りたたみ／展開
HNRNPA 1; Helix destabilizing protein; Helix-destabilizing protein; Heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1B protein; Heterogeneous nuclear ribonucleoprotein B2 protein; Heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP core protein A1; HNRNPA1; HNRPA1; MGC102835; Nuclear ribonucleoprotein particle A1 protein; ROA1_HUMAN; Single strand DNA binding protein UP1; Single strand RNA binding protein; Single-strand RNA-binding protein;
免疫原
A synthesized peptide derived from human hnRNP A1, corresponding to a region within the internal amino acids.
- P09651 ROA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
PTMs - P09651 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| S2 | Acetylation | Uniprot | |
| S2 | Phosphorylation | Uniprot | |
| K3 | Acetylation | Uniprot | |
| K3 | Ubiquitination | Uniprot | |
| S4 | Phosphorylation | Q9UBS0 (RPS6KB2) | Uniprot |
| S6 | Phosphorylation | Q9UBS0 (RPS6KB2) | Uniprot |
| K8 | Acetylation | Uniprot | |
| K8 | Ubiquitination | Uniprot | |
| R14 | Methylation | Uniprot | |
| K15 | Acetylation | Uniprot | |
| K15 | Sumoylation | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| S22 | Phosphorylation | Uniprot | |
| T25 | Phosphorylation | Uniprot | |
| S29 | Phosphorylation | Uniprot | |
| R31 | Methylation | Uniprot | |
| C43 | S-Nitrosylation | Uniprot | |
| K52 | Acetylation | Uniprot | |
| K52 | Ubiquitination | Uniprot | |
| R55 | Methylation | Uniprot | |
| T61 | Phosphorylation | Uniprot | |
| Y62 | Phosphorylation | Uniprot | |
| K78 | Ubiquitination | Uniprot | |
| K87 | Acetylation | Uniprot | |
| K87 | Ubiquitination | Uniprot | |
| S91 | Phosphorylation | Uniprot | |
| S95 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| T103 | Phosphorylation | Uniprot | |
| K105 | Acetylation | Uniprot | |
| K105 | Ubiquitination | Uniprot | |
| K106 | Methylation | Uniprot | |
| K106 | Ubiquitination | Uniprot | |
| K113 | Acetylation | Uniprot | |
| K113 | Sumoylation | Uniprot | |
| K113 | Ubiquitination | Uniprot | |
| R122 | Methylation | Uniprot | |
| Y124 | Phosphorylation | Uniprot | |
| Y128 | Phosphorylation | Uniprot | |
| T138 | Phosphorylation | Uniprot | |
| R140 | Methylation | Uniprot | |
| S142 | Phosphorylation | Uniprot | |
| K144 | Acetylation | Uniprot | |
| K144 | Ubiquitination | Uniprot | |
| K145 | Acetylation | Uniprot | |
| R146 | Methylation | Uniprot | |
| S158 | Phosphorylation | Uniprot | |
| K161 | Methylation | Uniprot | |
| K161 | Ubiquitination | Uniprot | |
| K166 | Acetylation | Uniprot | |
| K166 | Ubiquitination | Uniprot | |
| Y167 | Phosphorylation | Uniprot | |
| T169 | Phosphorylation | Uniprot | |
| C175 | S-Nitrosylation | Uniprot | |
| K183 | Sumoylation | Uniprot | |
| K183 | Ubiquitination | Uniprot | |
| S190 | Phosphorylation | Uniprot | |
| S191 | Phosphorylation | Uniprot | |
| S192 | Phosphorylation | Q9BUB5 (MKNK1) | Uniprot |
| R194 | Methylation | Uniprot | |
| R196 | Methylation | Uniprot | |
| S197 | Phosphorylation | Uniprot | |
| S199 | Phosphorylation | P17612 (PRKACA) , P68400 (CSNK2A1) , P31749 (AKT1) | Uniprot |
| R206 | Methylation | Uniprot | |
| R218 | Methylation | Uniprot | |
| R225 | Methylation | Uniprot | |
| R232 | Methylation | Uniprot | |
| Y244 | Phosphorylation | Uniprot | |
| Y253 | Phosphorylation | Uniprot | |
| R265 | Methylation | Uniprot | |
| Y312 | Phosphorylation | Uniprot | |
| Y318 | Phosphorylation | Uniprot | |
| K329 | Sumoylation | Uniprot | |
| R336 | Methylation | Uniprot | |
| S337 | Phosphorylation | Uniprot | |
| S338 | Phosphorylation | Uniprot | |
| Y341 | Phosphorylation | Uniprot | |
| Y347 | Phosphorylation | Uniprot | |
| K350 | Acetylation | Uniprot | |
| K350 | Methylation | Uniprot | |
| K350 | Sumoylation | Uniprot | |
| K350 | Ubiquitination | Uniprot | |
| R352 | Methylation | Uniprot | |
| Y357 | Phosphorylation | Uniprot | |
| S360 | Phosphorylation | Uniprot | |
| S361 | Phosphorylation | Uniprot | |
| S362 | Phosphorylation | Q9BUB5 (MKNK1) | Uniprot |
| S363 | Phosphorylation | Q9BUB5 (MKNK1) | Uniprot |
| S364 | Phosphorylation | Q9BUB5 (MKNK1) | Uniprot |
| S365 | Phosphorylation | Uniprot | |
| Y366 | Phosphorylation | Uniprot | |
| S368 | Phosphorylation | Uniprot | |
| R370 | Methylation | Uniprot | |
| R371 | Methylation | Uniprot |
研究背景
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May bind to specific miRNA hairpins. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1.
(Microbial infection) May play a role in HCV RNA replication.
(Microbial infection) Cleavage by Enterovirus 71 protease 3C results in increased translation of apoptosis protease activating factor APAF1, leading to apoptosis.
Arg-194, Arg-206 and Arg-225 are dimethylated, probably to asymmetric dimethylarginine.
Sumoylated.
Nucleus. Cytoplasm.
Note: Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles continuously between the nucleus and the cytoplasm along with mRNA. Component of ribonucleosomes (PubMed:17289661).
Cytoplasm.
Note: (Microbial infection) In the course of viral infection, colocalizes with HCV NS5B at speckles in the cytoplasm in a HCV-replication dependent manner.
Identified in the spliceosome C complex. Identified in a IGF2BP1-dependent mRNP granule complex containing untranslated mRNAs. Interacts with SEPT6. Interacts with C9orf72. Interacts with KHDRBS1. Interacts with UBQLN2.
(Microbial infection) Interacts with HCV NS5B and with the 5'-UTR and 3'-UTR of HCV RNA.
研究領域
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.