AFfirm™ ATIC Mouse Monoclonal Antibody - #BF9428
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
折りたたみ／展開
AICAR formyltransferase/IMP cyclohydrolase; 5 aminoimidazole 4 carboxamide 1 beta D ribonucleotide transformylase/inosinicase; 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase; 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase; 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase; AICAR; AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme; AICAR transformylase; AICARFT; AICARFT/IMPCHASE; ATIC; Bifunctional purine biosynthesis protein PURH; epididymis secretory sperm binding protein Li 70p; FLJ93545; HEL-S-70p; IMP cyclohydrolase; IMP synthase; IMP synthetase; IMPCHASE; Inosinicase; OK/SW-cl.86; Phosphoribosylaminoimidazolecarboxamide formyltransferase; Phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; PUR9_HUMAN; PURH;
免疫原
- P31939 PUR9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
PTMs - P31939 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K14 | Ubiquitination | Uniprot | |
| T25 | Phosphorylation | Uniprot | |
| S34 | Phosphorylation | Uniprot | |
| T37 | Phosphorylation | Uniprot | |
| K39 | Ubiquitination | Uniprot | |
| R42 | Methylation | Uniprot | |
| S52 | Phosphorylation | Uniprot | |
| K66 | Ubiquitination | Uniprot | |
| R79 | Methylation | Uniprot | |
| Y104 | Phosphorylation | Q9UM73 (ALK) | Uniprot |
| K108 | Ubiquitination | Uniprot | |
| S112 | Phosphorylation | Uniprot | |
| K137 | Ubiquitination | Uniprot | |
| T166 | Phosphorylation | Uniprot | |
| K177 | Ubiquitination | Uniprot | |
| T180 | Phosphorylation | Uniprot | |
| T182 | Phosphorylation | Uniprot | |
| S190 | Phosphorylation | Uniprot | |
| Y192 | Phosphorylation | Uniprot | |
| K199 | Acetylation | Uniprot | |
| K199 | Ubiquitination | Uniprot | |
| Y208 | Phosphorylation | Uniprot | |
| Y220 | Phosphorylation | Uniprot | |
| K254 | Ubiquitination | Uniprot | |
| S264 | Phosphorylation | Uniprot | |
| K266 | Acetylation | Uniprot | |
| K266 | Ubiquitination | Uniprot | |
| S269 | Phosphorylation | Uniprot | |
| S280 | Phosphorylation | Uniprot | |
| K285 | Ubiquitination | Uniprot | |
| Y290 | Phosphorylation | Uniprot | |
| Y293 | Phosphorylation | Uniprot | |
| K294 | Ubiquitination | Uniprot | |
| T295 | Phosphorylation | Uniprot | |
| T297 | Phosphorylation | Uniprot | |
| S300 | Phosphorylation | Uniprot | |
| Y303 | Phosphorylation | Uniprot | |
| R305 | Methylation | Uniprot | |
| K331 | Ubiquitination | Uniprot | |
| S338 | Phosphorylation | Uniprot | |
| S355 | Phosphorylation | Uniprot | |
| K356 | Acetylation | Uniprot | |
| K356 | Ubiquitination | Uniprot | |
| K357 | Ubiquitination | Uniprot | |
| K372 | Ubiquitination | Uniprot | |
| S387 | Phosphorylation | Uniprot | |
| K389 | Ubiquitination | Uniprot | |
| K397 | Ubiquitination | Uniprot | |
| S398 | Phosphorylation | Uniprot | |
| S401 | Phosphorylation | Uniprot | |
| T405 | Phosphorylation | Uniprot | |
| K406 | Ubiquitination | Uniprot | |
| K408 | Ubiquitination | Uniprot | |
| S413 | Phosphorylation | Uniprot | |
| T422 | Phosphorylation | Uniprot | |
| C434 | S-Nitrosylation | Uniprot | |
| K437 | Ubiquitination | Uniprot | |
| K461 | Ubiquitination | Uniprot | |
| Y464 | Phosphorylation | Uniprot | |
| K477 | Ubiquitination | Uniprot | |
| K507 | Sumoylation | Uniprot | |
| K507 | Ubiquitination | Uniprot | |
| K509 | Sumoylation | Uniprot | |
| K509 | Ubiquitination | Uniprot | |
| T520 | Phosphorylation | Uniprot | |
| K524 | Ubiquitination | Uniprot | |
| S537 | Phosphorylation | Uniprot |
研究背景
Bifunctional enzyme that catalyzes 2 steps in purine biosynthesis.
Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization.
Homodimer. Associates with internalized INSR complexes on Golgi/endosomal membranes. Interacts with INSR; ATIC together with PRKAA2/AMPK2 and HACD3/PTPLAD1 is proposed to be part of a signaling network regulating INSR autophosphorylation and endocytosis.
The IMP cyclohydrolase activity resides in the N-terminal region.
Belongs to the PurH family.
研究領域
· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > One carbon pool by folate.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.