KAPCG Antibody - #DF3121
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# DF3121, RRID:AB_2835498.
折りたたみ／展開
cAMP-dependent protein kinase catalytic subunit gamma; KAPCG_HUMAN; KAPG; PKA C gamma; PKA C-gamma; PKACg; PRKACG; Protein kinase cAMP dependent catalytic gamma; Serine (threonine) protein kinase;
免疫原
Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.
- P22612 KAPCG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
PTMs - P22612 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y118 | Phosphorylation | Uniprot | |
| Y123 | Phosphorylation | Uniprot | |
| R132 | Methylation | Uniprot | |
| T196 | Phosphorylation | Uniprot | |
| T198 | Phosphorylation | Uniprot | |
| T202 | Phosphorylation | Uniprot | |
| K214 | Ubiquitination | Uniprot | |
| K310 | Ubiquitination | Uniprot |
PTMs - P22612 酵素として
研究背景
Phosphorylates a large number of substrates in the cytoplasm and the nucleus.
Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.
A number of inactive tetrameric holoenzymes are produced by the combination of homo- or heterodimers of the different regulatory subunits associated with two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits.
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.
研究領域
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Gap junction. (View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hedgehog signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Substance dependence > Cocaine addiction.
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Substance dependence > Morphine addiction.
· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Aging > Longevity regulating pathway. (View pathway)
· Organismal Systems > Aging > Longevity regulating pathway - multiple species. (View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Immune system > Platelet activation. (View pathway)
· Organismal Systems > Environmental adaptation > Circadian entrainment.
· Organismal Systems > Nervous system > Long-term potentiation.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Nervous system > GABAergic synapse.
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Sensory system > Olfactory transduction.
· Organismal Systems > Sensory system > Taste transduction.
· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels. (View pathway)
· Organismal Systems > Endocrine system > Insulin signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)
· Organismal Systems > Endocrine system > Ovarian steroidogenesis.
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
· Organismal Systems > Endocrine system > Estrogen signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Melanogenesis.
· Organismal Systems > Endocrine system > Thyroid hormone synthesis.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Endocrine system > Glucagon signaling pathway.
· Organismal Systems > Endocrine system > Regulation of lipolysis in adipocytes.
· Organismal Systems > Endocrine system > Renin secretion.
· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
· Organismal Systems > Digestive system > Salivary secretion.
· Organismal Systems > Digestive system > Gastric acid secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.