TAF15 Antibody - #DF3382
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# DF3382, RRID:AB_2835764.
折りたたみ／展開
68 kDa TATA-binding protein-associated factor; Npl3; RBP56; RBP56_HUMAN; RNA binding protein 56; RNA-binding protein 56; TAF; TAF(II)68; TAF15; TAF15 RNA polymerase II TATA box binding protein (TBP) associated factor 68kDa; TAF2N; TAFII68; TATA-binding protein-associated factor 2N;
免疫原
- Q92804 RBP56_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q92804 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y50 | Phosphorylation | Uniprot | |
| Y70 | Phosphorylation | Uniprot | |
| S76 | Phosphorylation | Uniprot | |
| S77 | Phosphorylation | Uniprot | |
| Y78 | Phosphorylation | Uniprot | |
| S79 | Phosphorylation | Uniprot | |
| Y83 | Phosphorylation | Uniprot | |
| S94 | Phosphorylation | Uniprot | |
| S95 | Phosphorylation | Uniprot | |
| S97 | Phosphorylation | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| Y110 | Phosphorylation | Uniprot | |
| S115 | Phosphorylation | Uniprot | |
| Y116 | Phosphorylation | Uniprot | |
| Y135 | Phosphorylation | Uniprot | |
| Y142 | Phosphorylation | Uniprot | |
| Y149 | Phosphorylation | Uniprot | |
| Y156 | Phosphorylation | Uniprot | |
| S157 | Phosphorylation | Uniprot | |
| T160 | Phosphorylation | Uniprot | |
| R164 | Methylation | Uniprot | |
| Y170 | Phosphorylation | Uniprot | |
| R175 | Methylation | Uniprot | |
| Y177 | Phosphorylation | Uniprot | |
| S180 | Phosphorylation | Uniprot | |
| R185 | Methylation | Uniprot | |
| R187 | Methylation | Uniprot | |
| Y190 | Phosphorylation | Uniprot | |
| K192 | Methylation | Uniprot | |
| R195 | Methylation | Uniprot | |
| T199 | Phosphorylation | Uniprot | |
| S201 | Phosphorylation | Uniprot | |
| S202 | Phosphorylation | Uniprot | |
| R206 | Methylation | Uniprot | |
| K210 | Methylation | Uniprot | |
| Y218 | Phosphorylation | Uniprot | |
| T222 | Phosphorylation | Uniprot | |
| S226 | Phosphorylation | Uniprot | |
| S228 | Phosphorylation | Uniprot | |
| S231 | Phosphorylation | Uniprot | |
| K261 | Ubiquitination | Uniprot | |
| K265 | Ubiquitination | Uniprot | |
| K268 | Acetylation | Uniprot | |
| K268 | Ubiquitination | Uniprot | |
| K277 | Methylation | Uniprot | |
| K277 | Ubiquitination | Uniprot | |
| S289 | Phosphorylation | Uniprot | |
| S295 | Phosphorylation | Uniprot | |
| K297 | Sumoylation | Uniprot | |
| K297 | Ubiquitination | Uniprot | |
| K306 | Acetylation | Uniprot | |
| K306 | Ubiquitination | Uniprot | |
| R320 | Methylation | Uniprot | |
| R321 | Methylation | Uniprot | |
| R326 | Methylation | Uniprot | |
| S330 | Phosphorylation | Uniprot | |
| R334 | Methylation | Uniprot | |
| R335 | Methylation | Uniprot | |
| R349 | Methylation | Uniprot | |
| K354 | Acetylation | Uniprot | |
| K354 | Ubiquitination | Uniprot | |
| S355 | Phosphorylation | Uniprot | |
| S375 | Phosphorylation | Uniprot | |
| R383 | Methylation | Uniprot | |
| S387 | Phosphorylation | Uniprot | |
| R388 | Methylation | Uniprot | |
| R395 | Methylation | Uniprot | |
| R397 | Methylation | Uniprot | |
| R403 | Methylation | Uniprot | |
| R415 | Methylation | Uniprot | |
| Y418 | Phosphorylation | Uniprot | |
| R422 | Methylation | Uniprot | |
| S423 | Phosphorylation | Uniprot | |
| Y427 | Phosphorylation | Uniprot | |
| R431 | Methylation | Uniprot | |
| S433 | Phosphorylation | Uniprot | |
| Y437 | Phosphorylation | Uniprot | |
| S438 | Phosphorylation | Uniprot | |
| R441 | Methylation | Uniprot | |
| S442 | Phosphorylation | Uniprot | |
| Y446 | Phosphorylation | Uniprot | |
| R450 | Methylation | Uniprot | |
| S451 | Phosphorylation | Uniprot | |
| Y455 | Phosphorylation | Uniprot | |
| R459 | Methylation | Uniprot | |
| Y463 | Phosphorylation | Uniprot | |
| R467 | Methylation | Uniprot | |
| Y471 | Phosphorylation | Uniprot | |
| R475 | Methylation | Uniprot | |
| Y479 | Phosphorylation | Uniprot | |
| R483 | Methylation | Uniprot | |
| Y486 | Phosphorylation | Uniprot | |
| R490 | Methylation | Uniprot | |
| Y494 | Phosphorylation | Uniprot | |
| R498 | Methylation | Uniprot | |
| Y501 | Phosphorylation | Uniprot | |
| R505 | Methylation | Uniprot | |
| Y508 | Phosphorylation | Uniprot | |
| R512 | Methylation | Uniprot | |
| R519 | Methylation | Uniprot | |
| R528 | Methylation | Uniprot | |
| Y531 | Phosphorylation | Uniprot | |
| R535 | Methylation | Uniprot | |
| R545 | Methylation | Uniprot | |
| R553 | Methylation | Uniprot | |
| S554 | Phosphorylation | Uniprot | |
| R562 | Methylation | Uniprot | |
| R570 | Methylation | Uniprot | |
| K576 | Methylation | Uniprot | |
| R580 | Methylation | Uniprot | |
| Y583 | Phosphorylation | Uniprot | |
| R588 | Methylation | Uniprot | |
| R590 | Methylation | Uniprot |
研究背景
RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Can enter the preinitiation complex together with the RNA polymerase II (Pol II).
Dimethylated by PRMT1 at Arg-206 to asymmetric dimethylarginine. The methylation may favor nuclear localization and positive regulation of TAF15 transcriptional activity.
ADP-ribosylated during genotoxic stress.
Nucleus. Cytoplasm.
Note: Shuttles from the nucleus to the cytoplasm.
Ubiquitous. Observed in all fetal and adult tissues.
Belongs to the RNA polymerase II (Pol II) transcriptional multiprotein complex, together with the TATA-binding protein (TBP) and other TBP-associated factors (TAF(II)s). Binds SF1.
Belongs to the RRM TET family.
研究領域
· Genetic Information Processing > Transcription > Basal transcription factors.
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.