Phospho-hnRPD (Ser83) Antibody - #AF0033
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# AF0033, RRID:AB_2834084.
折りたたみ／展開
ARE binding protein AUFI type A; AU-rich element RNA-binding protein 1; AUF; AUF1; AUF1A; Heterogeneous nuclear ribonucleoprotein D0; hnRNP D; hnRNP D0; Hnrnpd; hnRNPD0; HNRPD; HNRPD_HUMAN; P37;
免疫原
- Q14103 HNRPD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14103 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| S2 | Phosphorylation | Uniprot | |
| S71 | Phosphorylation | Uniprot | |
| K72 | Acetylation | Uniprot | |
| K72 | Ubiquitination | Uniprot | |
| S80 | Phosphorylation | Uniprot | |
| S82 | Phosphorylation | Uniprot | |
| S83 | Phosphorylation | P49841 (GSK3B) | Uniprot |
| S87 | Phosphorylation | P17612 (PRKACA) | Uniprot |
| T91 | Phosphorylation | Uniprot | |
| R94 | Methylation | Uniprot | |
| S105 | Phosphorylation | Uniprot | |
| K110 | Acetylation | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| K111 | Acetylation | Uniprot | |
| K111 | Ubiquitination | Uniprot | |
| K114 | Acetylation | Uniprot | |
| K114 | Ubiquitination | Uniprot | |
| K119 | Acetylation | Uniprot | |
| K119 | Ubiquitination | Uniprot | |
| C126 | S-Nitrosylation | Uniprot | |
| T127 | Phosphorylation | Uniprot | |
| K129 | Acetylation | Uniprot | |
| K129 | Ubiquitination | Uniprot | |
| T134 | Phosphorylation | Uniprot | |
| S137 | Phosphorylation | Uniprot | |
| R138 | Methylation | Uniprot | |
| K153 | Acetylation | Uniprot | |
| K153 | Ubiquitination | Uniprot | |
| K158 | Acetylation | Uniprot | |
| K165 | Acetylation | Uniprot | |
| K165 | Ubiquitination | Uniprot | |
| K183 | Ubiquitination | Uniprot | |
| S190 | Phosphorylation | Uniprot | |
| T193 | Phosphorylation | P24941 (CDK2) | Uniprot |
| K197 | Acetylation | Uniprot | |
| K197 | Sumoylation | Uniprot | |
| K197 | Ubiquitination | Uniprot | |
| Y201 | Phosphorylation | Uniprot | |
| S210 | Phosphorylation | Uniprot | |
| K218 | Acetylation | Uniprot | |
| K218 | Methylation | Uniprot | |
| K218 | Ubiquitination | Uniprot | |
| C226 | S-Nitrosylation | Uniprot | |
| K231 | Acetylation | Uniprot | |
| K231 | Ubiquitination | Uniprot | |
| K238 | Acetylation | Uniprot | |
| K243 | Acetylation | Uniprot | |
| K243 | Ubiquitination | Uniprot | |
| Y244 | Phosphorylation | Uniprot | |
| K251 | Acetylation | Uniprot | |
| K251 | Ubiquitination | Uniprot | |
| K255 | Ubiquitination | Uniprot | |
| K260 | Methylation | Uniprot | |
| K260 | Ubiquitination | Uniprot | |
| Y263 | Phosphorylation | Uniprot | |
| S271 | Phosphorylation | Uniprot | |
| R272 | Methylation | Uniprot | |
| R278 | Methylation | Uniprot | |
| R280 | Methylation | Uniprot | |
| R282 | Methylation | Uniprot | |
| R345 | Methylation | Uniprot | |
| S351 | Phosphorylation | Uniprot | |
| K353 | Acetylation | Uniprot | |
| K353 | Methylation | Uniprot |
研究背景
Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3'UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.
Arg-345 is dimethylated, probably to asymmetric dimethylarginine.
Methylated by PRMT1, in an insulin-dependent manner. The PRMT1-mediated methylation regulates tyrosine phosphorylation (By similarity).
Nucleus. Cytoplasm.
Note: Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Component of ribonucleosomes. Cytoplasmic localization oscillates diurnally.
Identified in a IGF2BP1-dependent mRNP granule complex containing untranslated mRNAs. Part of a complex associated with the FOS mCRD domain and consisting of PABPC1, PAIP1, CSDE1/UNR and SYNCRIP. Interacts with IGF2BP2. Interacts with GTPBP1. Interacts with EIF4G1; the interaction requires RNA. Interacts with EIF3B and RPS3.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.